close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame rank 2 upgrade.
Ancient Flame (effect#1) base_value 35.00 25.00
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second39,547 (12.07%)39,270 (11.28%)38,009 (7.71%)37,558 (6.43%)37,159 (5.30%)36,700 (4.00%)36,687 (3.96%)36,675 (3.93%)36,586 (3.68%)36,214 (2.62%)36,024 (2.09%)35,288visionslife-forcelucid dreamsblood of the enemycrucible of flameworldveinfocusing irisunbound forceconflict+striferipple in spacepurification protocolbase

Actions per Minute / DPS Variance Summary

base : 35288 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
35288.3 35288.3 24.7 / 0.070% 4279.5 / 12.1% 4285.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 35288
Heed My Call 293 (419) 0.8% (1.2%) 8.2 33.14sec 15341 0 Direct 8.2 9104 18209 10735 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 0.0000 0.0000 88017.18 88017.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.73 82.08% 9104.21 8901 9791 9104.36 0 9791 61268 61268 0.00
crit 1.47 17.92% 18209.43 17802 19582 14160.57 0 19582 26750 26750 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.4% 8.2 33.14sec 4605 0 Direct 8.2 3902 7805 4605 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 0.0000 0.0000 37753.46 37753.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.99% 3901.68 3815 4196 3901.76 0 4196 26226 26226 0.00
crit 1.48 18.01% 7805.20 7629 8392 6070.15 0 8392 11528 11528 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5069 14.4% 77.7 3.78sec 19544 14907 Direct 77.7 16570 33124 19545 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.75 77.75 0.00 0.00 1.3111 0.0000 1519514.13 1519514.13 0.00 14907.43 14907.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.78 82.03% 16569.75 8882 21253 16576.91 15972 17413 1056757 1056757 0.00
crit 13.97 17.97% 33124.17 17765 42507 33139.87 29635 37590 462757 462757 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2456 7.0% 14.1 21.40sec 52329 51660 Direct 14.1 2860 5719 3370 17.8%  
Periodic 221.9 2630 5254 3103 18.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 221.95 221.95 1.0130 1.3420 735995.40 735995.40 0.00 2358.14 51659.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.56 82.16% 2860.29 2589 3565 2862.26 2643 3136 33052 33052 0.00
crit 2.51 17.84% 5718.62 5177 7129 5355.92 0 7129 14348 14348 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.0 81.99% 2629.72 2 3319 2630.95 2559 2756 478514 478514 0.00
crit 40.0 18.01% 5254.34 13 6638 5256.26 4870 5672 210081 210081 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 794 2.3% 44.3 6.62sec 5380 0 Direct 44.3 4565 9113 5381 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.25 44.25 0.00 0.00 0.0000 0.0000 238097.11 238097.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.31 82.06% 4564.63 4180 5756 4566.63 4218 4936 165759 165759 0.00
crit 7.94 17.94% 9113.42 8360 11513 9113.65 0 11513 72339 72339 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2852 (4499) 8.1% (12.8%) 94.5 3.12sec 14272 15775 Direct 95.0 7633 15255 8998 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.47 94.98 0.00 0.00 0.9047 0.0000 854623.24 854623.24 0.00 15775.00 15775.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.97 82.09% 7633.35 6967 9594 7637.97 7382 8070 595163 595163 0.00
crit 17.01 17.91% 15255.42 13933 19188 15263.86 14057 17189 259460 259460 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1647 4.7% 74.8 3.93sec 6595 0 Direct 74.8 6595 0 6595 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.85 74.85 0.00 0.00 0.0000 0.0000 493618.92 493618.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.85 100.00% 6594.99 5086 14007 6598.76 5781 7765 493619 493619 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11906 33.8% 61.6 4.92sec 57862 54928 Direct 61.4 49245 98356 58046 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.64 61.45 0.00 0.00 1.0534 0.0000 3566879.09 3566879.09 0.00 54928.30 54928.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.44 82.08% 49245.15 45067 61614 49268.47 47444 51554 2483822 2483822 0.00
crit 11.01 17.92% 98355.86 90135 123227 98391.38 90135 112025 1083057 1083057 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1595 4.5% 12.8 23.58sec 37356 36275 Direct 12.8 2423 4845 2858 17.9%  
Periodic 219.6 1704 3406 2010 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 219.62 219.62 1.0299 1.3447 478030.74 478030.74 0.00 1549.55 36274.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.50 82.06% 2423.29 2231 3073 2423.86 2251 2675 25447 25447 0.00
crit 2.30 17.94% 4845.34 4463 6146 4461.81 0 6146 11125 11125 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.1 82.02% 1704.21 1 2151 1705.02 1658 1785 306977 306977 0.00
crit 39.5 17.98% 3405.75 126 4302 3407.07 3177 3727 134482 134482 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5819 16.4% 90.1 3.10sec 19258 0 Direct 90.1 16348 32706 19258 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.07 90.07 0.00 0.00 0.0000 0.0000 1734568.38 1734568.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.05 82.21% 16347.82 15985 17583 16347.43 15985 17268 1210519 1210519 0.00
crit 16.02 17.79% 32706.25 31970 35167 32705.52 31970 34938 524050 524050 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2732 7.7% 17.9 16.78sec 45834 44656 Direct 17.9 3912 7830 4622 18.1%  
Periodic 221.1 2825 5644 3330 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 221.10 221.10 1.0264 1.3432 818718.97 818718.97 0.00 2596.51 44655.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.63 81.88% 3911.87 3570 4917 3912.61 3641 4285 57213 57213 0.00
crit 3.24 18.12% 7830.40 7141 9834 7640.02 0 9834 25350 25350 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.5 82.09% 2824.57 4 3565 2825.91 2732 2961 512653 512653 0.00
crit 39.6 17.91% 5644.33 20 7129 5646.53 5269 6106 223503 223503 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.66sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9091 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.2 44.0sec 4.9sec 93.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.81%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:10.59%
  • arcanic_pulsar_5:13.75%
  • arcanic_pulsar_6:10.60%
  • arcanic_pulsar_7:10.75%
  • arcanic_pulsar_8:14.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.11% 7.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.97% 32.51% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.5sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.3 46.4 8.9sec 3.7sec 82.34% 99.73% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.90%
  • lunar_empowerment_2:32.08%
  • lunar_empowerment_3:14.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.5 64.5sec 33.9sec 47.59% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.0 52.2 11.9sec 3.9sec 85.72% 78.93% 0.3(0.3) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.18%
  • solar_empowerment_2:39.82%
  • solar_empowerment_3:17.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.3 20.2sec 4.9sec 97.83% 92.78% 16.1(16.1) 11.5

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.11%
  • starlord_2:22.63%
  • starlord_3:61.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.62% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 61.6 2465.8 40.0 40.0 1446.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.47 763.68 (31.45%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.29%) 40.00 0.00 0.00%
sunfire Astral Power 17.86 53.59 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.25 177.01 (7.29%) 4.00 0.01 0.00%
moonfire Astral Power 14.06 42.19 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.37 (4.22%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.75 932.91 (38.42%) 12.00 0.06 0.01%
natures_balance Astral Power 400.63 200.31 (8.25%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.33 75.99 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.09 8.22
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.18 0.00 59.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data base Damage Per Second
Count 7806
Mean 35288.29
Minimum 32137.22
Maximum 40071.36
Spread ( max - min ) 7934.14
Range [ ( max - min ) / 2 * 100% ] 11.24%
Standard Deviation 1111.3360
5th Percentile 33524.32
95th Percentile 37175.90
( 95th Percentile - 5th Percentile ) 3651.58
Mean Distribution
Standard Deviation 12.5786
95.00% Confidence Intervall ( 35263.64 - 35312.94 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3811
0.1 Scale Factor Error with Delta=300 10544
0.05 Scale Factor Error with Delta=300 42173
0.01 Scale Factor Error with Delta=300 1054325
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 7806
Mean 35288.29
Minimum 32137.22
Maximum 40071.36
Spread ( max - min ) 7934.14
Range [ ( max - min ) / 2 * 100% ] 11.24%
Standard Deviation 1111.3360
5th Percentile 33524.32
95th Percentile 37175.90
( 95th Percentile - 5th Percentile ) 3651.58
Mean Distribution
Standard Deviation 12.5786
95.00% Confidence Intervall ( 35263.64 - 35312.94 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3811
0.1 Scale Factor Error with Delta=300 10544
0.05 Scale Factor Error with Delta=300 42173
0.01 Scale Factor Error with Delta=300 1054325
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 7806
Mean 35288.29
Minimum 32137.22
Maximum 40071.36
Spread ( max - min ) 7934.14
Range [ ( max - min ) / 2 * 100% ] 11.24%
Damage
Sample Data base Damage
Count 7806
Mean 10565816.60
Minimum 8279918.49
Maximum 13154474.94
Spread ( max - min ) 4874556.45
Range [ ( max - min ) / 2 * 100% ] 23.07%
DTPS
Sample Data base Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.88 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 61.64 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.89 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.07 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.99 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.12 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.73 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.21 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPJQPQJQPMQPNQPQJOJQPPJQPPQQPJQJQPQPQIJMNPJPPJOQPJMQPPQJPNQJQPPJMOQPQPQQJQJQJQLPPJMPPOQQPQJJPPJNMQPPJQPQPOQPJQJMGQPQJLQPQPJQPPQQIJJMOPJQPPJNQPPQQQQQJJMPOJQPQPJLQPPQMPIJQPJQHEFQJQOQPJNQPMQIJQPJQPQJKPPQPQJOQPIJQJNQPQJMQPJQPQPQQQJJNOPMPGJQPQJPPQQPQJQJQOQPJMNPPJPPQQQQJMPJNPOJQPQQJPQMQPJPQJQPJQPLOQJPMQQQQJPJQPNPJQPPJQPQQPJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.183 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.118 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.054 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.867 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.867 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.867 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.621 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.376 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.251 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.007 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.760 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.611 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.367 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.122 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.941 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.694 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.449 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.206 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.961 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.714 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.468 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.221 default N moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.975 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.730 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.518 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.274 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.027 default O stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.782 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.537 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.292 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.088 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.005 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers
0:25.873 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:26.629 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:27.707 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:28.789 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:29.542 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:30.297 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:31.391 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:32.252 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), conch_of_dark_whispers
0:33.007 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
0:33.763 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
0:34.519 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
0:35.483 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
0:36.246 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
0:37.219 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:37.986 default I cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:37.986 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), conch_of_dark_whispers
0:38.822 default M sunfire Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers
0:39.755 default N moonfire Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers
0:40.686 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers
0:41.874 default J starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:43.088 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:44.588 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:46.089 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:47.266 default O stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:48.413 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:49.384 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:50.843 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:51.989 default M sunfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:53.136 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:54.110 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:55.570 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:57.030 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:58.003 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), solar_empowerment
0:59.253 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:00.797 default N moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord
1:02.008 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord
1:03.037 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord
1:04.250 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
1:05.252 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:06.751 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:08.251 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:09.430 default M sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:10.574 default O stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:11.718 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:12.691 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:14.150 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:15.124 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:16.585 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:17.559 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:18.534 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8)
1:19.782 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:20.678 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, starlord
1:21.734 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:22.607 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
1:23.634 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:24.481 default L moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3)
1:25.479 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3)
1:26.940 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
1:28.401 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
1:29.546 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
1:30.690 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
1:32.148 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:33.608 default O stellar_flare Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:34.755 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:35.726 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements
1:36.699 default P lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
1:38.032 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(23)
1:39.085 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(3), lunar_empowerment, torrent_of_elements, overwhelming_power(22)
1:40.236 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21)
1:41.360 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
1:42.757 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:44.157 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:45.264 default N moonfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
1:46.345 default M sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
1:47.429 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
1:48.356 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
1:49.747 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
1:51.144 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
1:52.248 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
1:53.191 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
1:54.608 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
1:55.557 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
1:56.983 default O stellar_flare Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
1:58.108 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(3)
1:59.069 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
2:00.517 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(7), solar_empowerment(2), overwhelming_power
2:01.761 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord
2:02.793 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
2:04.007 default M sunfire Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:05.031 default G use_items Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:05.031 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse
2:05.870 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse
2:07.121 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse
2:07.956 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:08.941 default L moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
2:09.898 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
2:10.797 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(2)
2:12.036 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), ignition_mages_fuse(2)
2:12.868 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(2)
2:14.113 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(3)
2:15.063 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(3)
2:15.874 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(3)
2:17.088 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
2:18.268 default Q solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(17), ignition_mages_fuse(4)
2:19.059 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(4)
2:19.851 default I cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(4)
2:19.851 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(2), overwhelming_power(25), ignition_mages_fuse(4)
2:20.839 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), ignition_mages_fuse(4)
2:21.801 default M sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), ignition_mages_fuse(5)
2:22.707 default O stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), ignition_mages_fuse(5)
2:23.619 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), ignition_mages_fuse(5)
2:24.783 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse(5)
2:25.700 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19)
2:26.609 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
2:27.976 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
2:29.348 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(15)
2:30.433 default N moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
2:31.520 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
2:32.446 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
2:33.844 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
2:35.177 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(23)
2:36.073 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(22)
2:36.972 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(22)
2:38.030 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(20)
2:39.094 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(19)
2:40.163 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(6), overwhelming_power(18)
2:41.334 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
2:42.475 default M sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
2:43.583 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15)
2:45.000 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13)
2:46.124 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
2:47.252 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
2:48.067 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
2:49.226 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24)
2:50.003 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
2:51.172 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
2:52.093 default L moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21)
2:53.015 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
2:53.921 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
2:55.280 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
2:56.647 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power(17)
2:57.563 default M sunfire Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
2:58.642 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
3:00.024 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(13)
3:00.024 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, solar_empowerment(2), overwhelming_power(13)
3:01.214 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(12)
3:02.200 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(11)
3:03.681 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(10)
3:04.849 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(9)
3:05.818 default H celestial_alignment Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8)
3:06.812 default E potion Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7)
3:06.812 default F berserking Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), battle_potion_of_intellect
3:06.812 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), battle_potion_of_intellect
3:07.585 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), battle_potion_of_intellect
3:08.497 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:09.253 default O stellar_flare Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:10.147 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:10.910 default P lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:12.051 default J starsurge Fluffy_Pillow 94.0/100: 94% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power, battle_potion_of_intellect
3:12.954 default N moonfire Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power, battle_potion_of_intellect
3:13.856 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:14.627 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:15.780 default M sunfire Fluffy_Pillow 79.5/100: 80% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.686 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.456 default I cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.456 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect
3:18.442 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:19.258 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:20.600 default J starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:21.654 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:22.526 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:23.831 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:24.703 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:25.726 default K sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:26.722 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:28.181 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:29.639 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:30.613 default P lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:32.071 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3)
3:33.045 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
3:34.193 default O stellar_flare Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:35.189 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:35.968 default P lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:37.133 default I cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
3:37.133 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, solar_empowerment(2), overwhelming_power(22), conch_of_dark_whispers
3:38.134 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(21), conch_of_dark_whispers
3:38.965 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(21), conch_of_dark_whispers
3:39.941 default N moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20), conch_of_dark_whispers
3:41.036 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(18), conch_of_dark_whispers
3:41.976 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers
3:43.380 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), conch_of_dark_whispers
3:44.326 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers
3:45.440 default M sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
3:46.527 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers
3:47.456 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
3:48.853 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
3:49.953 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10)
3:50.894 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
3:52.228 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
3:53.125 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
3:54.472 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(21)
3:55.373 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(20)
3:56.279 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
3:57.190 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(4), torrent_of_elements, overwhelming_power(18)
3:58.358 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17)
3:59.497 default N moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16)
4:00.607 default O stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15)
4:01.721 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
4:03.147 default M sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(12)
4:04.273 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11)
4:05.712 default G use_items Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10)
4:05.712 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse
4:06.803 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse
4:07.709 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse
4:09.068 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), ignition_mages_fuse
4:09.984 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), ignition_mages_fuse(2)
4:11.018 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(2)
4:12.346 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), ignition_mages_fuse(2)
4:13.676 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse(2)
4:14.568 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power, ignition_mages_fuse(3)
4:15.428 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), ignition_mages_fuse(3)
4:16.723 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), starlord(3), ignition_mages_fuse(3)
4:17.739 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, ignition_mages_fuse(4)
4:18.807 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(4)
4:19.574 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(4)
4:20.477 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(4)
4:21.232 default O stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.108 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.955 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.032 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.878 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.824 default N moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:26.970 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:28.431 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:29.889 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:31.033 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:32.492 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:33.950 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:34.923 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:35.898 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:37.044 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:38.189 default J starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(3), conch_of_dark_whispers
4:39.439 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
4:40.651 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:42.196 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment, starlord
4:43.409 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:44.587 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:46.088 default O stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
4:47.265 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
4:48.443 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
4:49.415 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
4:50.875 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3)
4:51.849 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(25)
4:52.740 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(24)
4:53.792 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23)
4:55.134 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(21)
4:56.037 default M sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(20)
4:57.101 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(19)
4:58.010 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(24)
4:59.347 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), overwhelming_power(23)
5:00.496 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22)
5:01.919 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(21)
5:02.875 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), starlord, overwhelming_power(20)
5:04.005 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(18)
5:04.821 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(18)
5:06.043 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, starlord(2), overwhelming_power(16)
5:07.010 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15)
5:07.812 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15)
5:09.015 default L moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(13)
5:09.964 default O stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(3), overwhelming_power(25)
5:11.011 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord(3), overwhelming_power(23)
5:12.064 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(3), overwhelming_power(22)
5:13.122 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
5:14.473 default M sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
5:15.540 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
5:16.448 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
5:17.359 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(17)
5:18.435 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(16)
5:19.516 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(15)
5:20.697 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14)
5:22.162 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(12)
5:23.322 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(11)
5:24.284 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25)
5:25.657 default N moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
5:26.739 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
5:28.119 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
5:29.210 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers
5:30.114 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
5:31.475 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
5:32.841 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
5:33.916 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), conch_of_dark_whispers
5:34.836 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
5:36.218 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
5:37.146 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
5:38.080 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
5:39.481 default J starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

blood of the enemy : 37558 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37557.8 37557.8 28.4 / 0.076% 4942.5 / 13.2% 4575.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 37558
Blood of the Enemy 362 1.0% 3.7 91.17sec 29436 30642 Direct 3.7 22903 57261 29431 19.0%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 3.68 0.00 0.00 0.9608 0.0000 108443.54 108443.54 0.00 30642.42 30642.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.98 80.99% 22902.77 22467 24714 22859.70 0 24714 68333 68333 0.00
crit 0.70 19.01% 57260.91 56168 61785 30691.31 0 61785 40111 40111 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20460.77
  • base_dd_max:20460.77
  • base_dd_mult:1.00
 
Heed My Call 309 (442) 0.8% (1.2%) 8.2 32.88sec 16090 0 Direct 8.2 9108 18717 11258 22.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 92814.85 92814.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 77.62% 9108.32 8901 9791 9101.57 0 9791 58285 58285 0.00
crit 1.84 22.38% 18717.13 17802 24477 15877.76 0 24477 34530 34530 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.4% 8.2 32.88sec 4832 0 Direct 8.2 3904 8022 4832 22.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 39831.62 39831.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.39 77.47% 3904.03 3815 4196 3902.64 0 4196 24934 24934 0.00
crit 1.86 22.53% 8021.96 7629 10490 6828.15 0 10490 14897 14897 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5225 13.9% 77.3 3.79sec 20261 15587 Direct 77.3 16498 33932 20260 21.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.29 77.29 0.00 0.00 1.2998 0.0000 1565972.81 1565972.81 0.00 15587.09 15587.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.61 78.42% 16497.77 8882 21253 16503.58 15828 17290 999923 999923 0.00
crit 16.68 21.58% 33931.92 17765 53133 33962.66 30641 38567 566050 566050 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2605 6.9% 14.1 21.39sec 55455 54979 Direct 14.1 2848 5913 3517 21.8%  
Periodic 224.0 2616 5510 3263 22.4% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 14.07 223.98 223.98 1.0087 1.3299 780419.89 780419.89 0.00 2500.78 54978.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 78.17% 2847.66 2589 3565 2849.04 2614 3184 31327 31327 0.00
crit 3.07 21.83% 5913.30 5177 8912 5767.15 0 8912 18167 18167 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.9 77.64% 2616.15 4 3319 2617.23 2544 2756 454921 454921 0.00
crit 50.1 22.36% 5510.19 6 8297 5515.21 5101 6085 276006 276006 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 843 2.2% 44.7 6.58sec 5652 0 Direct 44.7 4540 9541 5652 22.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.70 44.70 0.00 0.00 0.0000 0.0000 252668.85 252668.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.76 77.76% 4539.77 4180 5756 4541.70 4305 4950 157795 157795 0.00
crit 9.94 22.24% 9541.30 8360 14391 9547.40 8360 12559 94873 94873 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2961 (4683) 7.9% (12.5%) 93.9 3.13sec 14945 16631 Direct 94.4 7588 15696 9397 22.3%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.90 94.40 0.00 0.00 0.8986 0.0000 887049.08 887049.08 0.00 16630.63 16630.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.34 77.69% 7587.63 6967 9594 7591.23 7325 8039 556488 556488 0.00
crit 21.06 22.31% 15695.86 13933 23984 15711.18 14459 17699 330561 330561 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1723 4.6% 74.5 3.93sec 6929 0 Direct 74.5 6929 0 6929 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.50 74.50 0.00 0.00 0.0000 0.0000 516226.51 516226.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.50 100.00% 6929.26 5086 17509 6935.29 5910 7979 516227 516227 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12560 33.5% 61.4 4.92sec 61232 58610 Direct 61.2 48964 103637 61429 22.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.43 61.24 0.00 0.00 1.0448 0.0000 3761570.67 3761570.67 0.00 58609.70 58609.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.27 77.20% 48963.91 45067 61614 48980.09 46849 51365 2314750 2314750 0.00
crit 13.96 22.80% 103636.90 90135 154034 103826.25 90135 123706 1446821 1446821 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1694 4.5% 12.8 23.58sec 39657 38675 Direct 12.8 2408 5128 3001 21.8%  
Periodic 221.7 1696 3573 2116 22.4% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 221.66 221.66 1.0254 1.3323 507460.97 507460.97 0.00 1645.23 38675.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.00 78.17% 2407.52 2231 3073 2407.21 2231 2617 24082 24082 0.00
crit 2.79 21.83% 5127.65 4463 7683 4940.41 0 7683 14323 14323 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.0 77.60% 1695.65 7 2151 1696.34 1647 1794 291685 291685 0.00
crit 49.6 22.40% 3572.96 2 5378 3576.33 3316 3938 177370 177370 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6251 16.6% 88.7 3.14sec 21010 0 Direct 88.7 16356 34099 21010 26.2%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.67 88.67 0.00 0.00 0.0000 0.0000 1862935.84 1862935.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.41 73.77% 16355.59 15985 17583 16355.14 15985 17220 1069807 1069807 0.00
crit 23.26 26.23% 34098.95 31970 43958 34112.19 31970 37120 793129 793129 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2892 7.7% 17.9 16.74sec 48506 47638 Direct 17.9 3901 8026 4782 21.4%  
Periodic 223.2 2811 5905 3500 22.3% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 223.17 223.17 1.0182 1.3308 866527.52 866527.52 0.00 2749.19 47637.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.05 78.65% 3900.99 3570 4917 3901.18 3642 4234 54806 54806 0.00
crit 3.81 21.35% 8026.09 7141 12292 7923.39 0 12292 30618 30618 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.5 77.73% 2810.87 6 3565 2812.02 2733 2959 487574 487574 0.00
crit 49.7 22.27% 5904.86 7 8912 5910.24 5487 6564 293529 293529 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.50sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.67sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9029 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.0 44.2sec 4.9sec 93.29% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.65%
  • arcanic_pulsar_2:10.25%
  • arcanic_pulsar_3:11.70%
  • arcanic_pulsar_4:10.83%
  • arcanic_pulsar_5:13.54%
  • arcanic_pulsar_6:10.33%
  • arcanic_pulsar_7:10.60%
  • arcanic_pulsar_8:14.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 7.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.2 0.0 57.7sec 57.7sec 13.73% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:592.56

Stack Uptimes

  • bloodsoaked_1:13.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 4.8 208.3 65.5sec 1.4sec 86.92% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.09

Stack Uptimes

  • bloodsoaked_counter_1:2.50%
  • bloodsoaked_counter_2:2.27%
  • bloodsoaked_counter_3:2.13%
  • bloodsoaked_counter_4:2.07%
  • bloodsoaked_counter_5:2.02%
  • bloodsoaked_counter_6:2.01%
  • bloodsoaked_counter_7:1.96%
  • bloodsoaked_counter_8:1.94%
  • bloodsoaked_counter_9:1.89%
  • bloodsoaked_counter_10:5.86%
  • bloodsoaked_counter_11:2.49%
  • bloodsoaked_counter_12:2.46%
  • bloodsoaked_counter_13:2.42%
  • bloodsoaked_counter_14:2.40%
  • bloodsoaked_counter_15:2.34%
  • bloodsoaked_counter_16:2.33%
  • bloodsoaked_counter_17:2.30%
  • bloodsoaked_counter_18:2.28%
  • bloodsoaked_counter_19:2.24%
  • bloodsoaked_counter_20:2.22%
  • bloodsoaked_counter_21:2.20%
  • bloodsoaked_counter_22:2.16%
  • bloodsoaked_counter_23:2.16%
  • bloodsoaked_counter_24:2.14%
  • bloodsoaked_counter_25:2.11%
  • bloodsoaked_counter_26:2.09%
  • bloodsoaked_counter_27:2.07%
  • bloodsoaked_counter_28:2.06%
  • bloodsoaked_counter_29:2.04%
  • bloodsoaked_counter_30:2.02%
  • bloodsoaked_counter_31:2.02%
  • bloodsoaked_counter_32:2.02%
  • bloodsoaked_counter_33:1.99%
  • bloodsoaked_counter_34:1.99%
  • bloodsoaked_counter_35:1.98%
  • bloodsoaked_counter_36:1.94%
  • bloodsoaked_counter_37:1.93%
  • bloodsoaked_counter_38:1.93%
  • bloodsoaked_counter_39:1.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.92% 32.33% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.76% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.0 46.3 8.9sec 3.7sec 82.12% 99.81% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.85%
  • lunar_empowerment_2:31.82%
  • lunar_empowerment_3:14.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.3sec 33.8sec 47.98% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.2sec 91.2sec 6.11% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.9 52.0 12.0sec 3.9sec 86.01% 79.06% 0.3(0.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.52%
  • solar_empowerment_2:39.79%
  • solar_empowerment_3:17.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.1 20.2sec 4.9sec 97.80% 93.01% 15.9(15.9) 11.5

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.64%
  • starlord_2:22.49%
  • starlord_3:60.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.9sec 45.7sec 23.63% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.4 2457.3 40.0 40.0 1530.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 94.90 759.11 (31.37%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.31%) 40.00 0.00 0.00%
sunfire Astral Power 17.86 53.59 (2.22%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.70 178.80 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.07 42.22 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.37 (4.23%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.29 927.44 (38.33%) 12.00 0.06 0.01%
natures_balance Astral Power 400.63 200.31 (8.28%) 0.50 0.01 0.00%
arcanic_pulsar Astral Power 6.31 75.68 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.06 8.19
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.92 0.00 74.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data blood of the enemy Damage Per Second
Count 7806
Mean 37557.85
Minimum 33652.62
Maximum 42281.86
Spread ( max - min ) 8629.24
Range [ ( max - min ) / 2 * 100% ] 11.49%
Standard Deviation 1281.1402
5th Percentile 35522.53
95th Percentile 39744.63
( 95th Percentile - 5th Percentile ) 4222.10
Mean Distribution
Standard Deviation 14.5005
95.00% Confidence Intervall ( 37529.43 - 37586.27 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4470
0.1 Scale Factor Error with Delta=300 14012
0.05 Scale Factor Error with Delta=300 56046
0.01 Scale Factor Error with Delta=300 1401126
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 7806
Mean 37557.85
Minimum 33652.62
Maximum 42281.86
Spread ( max - min ) 8629.24
Range [ ( max - min ) / 2 * 100% ] 11.49%
Standard Deviation 1281.1402
5th Percentile 35522.53
95th Percentile 39744.63
( 95th Percentile - 5th Percentile ) 4222.10
Mean Distribution
Standard Deviation 14.5005
95.00% Confidence Intervall ( 37529.43 - 37586.27 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4470
0.1 Scale Factor Error with Delta=300 14012
0.05 Scale Factor Error with Delta=300 56046
0.01 Scale Factor Error with Delta=300 1401126
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 7806
Mean 37557.85
Minimum 33652.62
Maximum 42281.86
Spread ( max - min ) 8629.24
Range [ ( max - min ) / 2 * 100% ] 11.49%
Damage
Sample Data blood of the enemy Damage
Count 7806
Mean 11241922.14
Minimum 8734306.17
Maximum 14306287.28
Spread ( max - min ) 5571981.10
Range [ ( max - min ) / 2 * 100% ] 24.78%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
H 3.68 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.88 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.43 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.81 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.99 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.78 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.08 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.66 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 94.15 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.27 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRKRQKRQRQKRQNRORQRKRKPRLQKQQQRRRRKRKRQRQRJKKONQKPRQKRQQRQRRRKKNOQKRQPQRRRRRJKNKRKRMQQKQQKRPQHNKRQRKQORQRKRQQNRPKQRKRQGRKRQOKRQNQRRQRKKQPQKRQRKONQRRRQRQKKRQQPRKNRKRQMQRRQKKQQRIEFHKNPRQKORQRQJKRQRKRQKLQQQRRKPRQJKRKOQKNQRQKRQQRQRKOPKNQQGRKQRRKQRRRQKNKRPRQKOQQRKQRRRQNHKKROQRKPRQQRKRNQRRKQQKRQKRQMPKNQRRRRKQKQRRORKQNRRKQRRRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:02.181 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:03.114 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.048 default I celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(4), battle_potion_of_intellect
0:04.803 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(5), battle_potion_of_intellect
0:04.803 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(5), battle_potion_of_intellect
0:04.803 default H blood_of_the_enemy Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(5), battle_potion_of_intellect, ignition_mages_fuse
0:05.557 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter(6), battle_potion_of_intellect, ignition_mages_fuse
0:06.312 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked_counter(7), battle_potion_of_intellect, ignition_mages_fuse
0:07.067 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse
0:07.819 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.576 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse
0:09.367 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(16), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.121 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.873 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.640 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.396 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.168 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(26), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.923 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.678 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), bloodsoaked_counter(31), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.431 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked_counter(33), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.187 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked_counter(34), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.942 default O moonfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(34), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.696 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(35), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.451 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(38), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.256 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked_counter(39), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.008 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(10), bloodsoaked_counter(39), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.762 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.517 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(9), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.272 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(8), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.028 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(7), bloodsoaked, ignition_mages_fuse(5)
0:23.783 default L sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(7), bloodsoaked, ignition_mages_fuse(5)
0:24.538 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), starlord(2), overwhelming_power(6), bloodsoaked, ignition_mages_fuse(5)
0:25.424 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), bloodsoaked
0:26.256 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked
0:27.290 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked
0:28.328 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
0:29.444 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
0:30.199 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
0:30.953 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements
0:31.835 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements
0:32.716 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements
0:33.597 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter
0:34.352 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter
0:35.120 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter
0:35.875 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter
0:36.854 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter
0:37.624 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter
0:38.602 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter
0:39.358 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, bloodsoaked_counter(2)
0:39.358 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, celestial_alignment, torrent_of_elements, bloodsoaked_counter(2)
0:40.196 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(2)
0:41.128 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(3)
0:42.307 default N sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(3)
0:43.485 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(4)
0:44.987 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(5)
0:46.165 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(6)
0:47.311 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(7)
0:48.283 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(7)
0:49.743 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(8)
0:50.888 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(8)
0:51.863 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10)
0:53.322 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(11)
0:54.782 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(11)
0:55.757 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(12)
0:57.216 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), bloodsoaked_counter(14)
0:58.189 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), bloodsoaked_counter(14)
0:59.163 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked_counter(15)
1:00.309 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(5), bloodsoaked_counter(15)
1:01.557 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(16)
1:02.770 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(18)
1:03.946 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(20)
1:05.123 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(20)
1:06.624 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(21)
1:07.700 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), bloodsoaked_counter(21)
1:08.594 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(23)
1:09.936 default P stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(24)
1:10.994 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(25)
1:12.347 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(25)
1:13.257 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(25)
1:14.166 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), bloodsoaked_counter(25)
1:15.243 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), bloodsoaked_counter(27)
1:16.325 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), bloodsoaked_counter(27)
1:17.409 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), bloodsoaked_counter(28)
1:17.409 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), overwhelming_power(14), bloodsoaked_counter(28)
1:18.594 default N sunfire Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), bloodsoaked_counter(29)
1:19.599 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(32)
1:20.608 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(33)
1:21.447 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(33)
1:22.435 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(35)
1:23.257 default M moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(36)
1:24.223 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(36)
1:25.645 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(37)
1:27.071 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(38)
1:28.199 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked
1:29.545 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), bloodsoaked
1:30.895 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked
1:31.960 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked
1:32.868 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked
1:33.936 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked
1:35.297 default H blood_of_the_enemy Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked
1:36.364 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power seething_rage, arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter
1:37.510 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power seething_rage, arcanic_pulsar(4), solar_empowerment(2), torrent_of_elements, bloodsoaked_counter
1:38.757 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, bloodsoaked_counter
1:39.787 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter
1:41.332 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter
1:42.362 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter
1:43.575 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(2)
1:45.076 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(2)
1:46.254 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(2)
1:47.256 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(3)
1:48.756 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(3)
1:49.757 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(4)
1:50.936 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(5)
1:51.909 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(5), conch_of_dark_whispers
1:53.367 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(6), conch_of_dark_whispers
1:54.825 default N sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(8), conch_of_dark_whispers
1:55.971 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), conch_of_dark_whispers
1:56.945 default P stellar_flare Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), bloodsoaked_counter(10), conch_of_dark_whispers
1:58.089 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(7), solar_empowerment, bloodsoaked_counter(12), conch_of_dark_whispers
1:59.338 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(13), conch_of_dark_whispers
2:00.882 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord, bloodsoaked_counter(15), conch_of_dark_whispers
2:01.913 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(25), bloodsoaked_counter(16), conch_of_dark_whispers
2:03.019 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(23), bloodsoaked_counter(17), conch_of_dark_whispers
2:03.822 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(17), conch_of_dark_whispers
2:05.013 default G use_items Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(23), bloodsoaked_counter(18), conch_of_dark_whispers
2:05.013 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(23), bloodsoaked_counter(18), conch_of_dark_whispers, ignition_mages_fuse
2:05.786 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), bloodsoaked_counter(22), conch_of_dark_whispers, ignition_mages_fuse
2:06.692 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), bloodsoaked_counter(22), ignition_mages_fuse
2:07.449 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(24), ignition_mages_fuse
2:08.580 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(24), ignition_mages_fuse
2:09.605 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(24), ignition_mages_fuse(2)
2:10.595 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), bloodsoaked_counter(26), ignition_mages_fuse(2)
2:11.440 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(26), ignition_mages_fuse(2)
2:12.712 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(26), ignition_mages_fuse(2)
2:13.711 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(27), ignition_mages_fuse(3)
2:14.944 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(29), ignition_mages_fuse(3)
2:15.771 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(31), ignition_mages_fuse(3)
2:16.599 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(31), ignition_mages_fuse(3)
2:17.845 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(11), bloodsoaked_counter(33), ignition_mages_fuse(4)
2:18.790 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), overwhelming_power(25), bloodsoaked_counter(33), ignition_mages_fuse(4)
2:19.779 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(34), ignition_mages_fuse(4)
2:20.743 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(34), ignition_mages_fuse(4)
2:21.938 default P stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(34), ignition_mages_fuse(5)
2:22.848 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(35), ignition_mages_fuse(5)
2:24.012 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(35), ignition_mages_fuse(5)
2:24.931 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(35), ignition_mages_fuse(5)
2:25.691 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(37)
2:27.057 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(39)
2:27.976 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(10), bloodsoaked
2:28.988 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(10), bloodsoaked
2:30.005 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(10), bloodsoaked
2:31.026 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(10), bloodsoaked
2:32.333 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(10), bloodsoaked
2:33.208 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(10), bloodsoaked
2:34.085 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(10), bloodsoaked
2:35.121 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(10), bloodsoaked
2:36.447 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(7), bloodsoaked_counter(10)
2:37.562 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(11)
2:38.989 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(5), bloodsoaked_counter(12)
2:40.215 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(3), bloodsoaked_counter(13)
2:41.414 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(2), bloodsoaked_counter(14)
2:42.409 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked_counter(14)
2:43.903 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(15)
2:45.404 default P stellar_flare Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(15)
2:46.581 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(15)
2:47.581 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(15)
2:48.760 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(15)
2:49.758 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(16)
2:50.606 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(16)
2:51.602 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(16)
2:52.450 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(18)
2:53.720 default M moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(20)
2:54.715 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(23)
2:56.175 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(23)
2:57.150 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(24)
2:58.123 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(25)
2:59.581 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar, bloodsoaked_counter(26)
3:00.831 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(26)
3:02.043 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(26)
3:03.544 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(27)
3:05.045 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(29)
3:06.048 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(31)
3:07.070 default E potion Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(31)
3:07.070 default F berserking Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(31), battle_potion_of_intellect
3:07.070 default H blood_of_the_enemy Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(31), battle_potion_of_intellect
3:08.003 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(33), battle_potion_of_intellect
3:08.935 default N sunfire Fluffy_Pillow 43.0/100: 43% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(34), battle_potion_of_intellect
3:09.841 default P stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(36), battle_potion_of_intellect
3:10.747 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(38), battle_potion_of_intellect
3:11.518 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(39), battle_potion_of_intellect
3:12.674 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:13.520 default O moonfire Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:14.365 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:15.118 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:16.195 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:16.950 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:18.026 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:18.026 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, bloodsoaked, battle_potion_of_intellect
3:18.947 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(25), bloodsoaked, battle_potion_of_intellect
3:19.702 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), bloodsoaked, battle_potion_of_intellect
3:20.857 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:21.684 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), bloodsoaked_counter, battle_potion_of_intellect
3:22.658 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(2), battle_potion_of_intellect
3:23.464 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(3), battle_potion_of_intellect
3:24.677 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(3), battle_potion_of_intellect
3:25.634 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(4), battle_potion_of_intellect
3:26.568 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(5), battle_potion_of_intellect
3:27.937 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(5), battle_potion_of_intellect
3:29.311 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(6), battle_potion_of_intellect
3:30.698 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(8), battle_potion_of_intellect
3:31.626 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(8), battle_potion_of_intellect
3:32.559 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11), bloodsoaked_counter(8)
3:33.661 default P stellar_flare Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), bloodsoaked_counter(10)
3:34.623 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(10)
3:35.445 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked_counter(10)
3:36.679 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(7), bloodsoaked_counter(10)
3:36.679 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power celestial_alignment, lunar_empowerment, overwhelming_power(7), bloodsoaked_counter(10)
3:37.738 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(6), bloodsoaked_counter(12)
3:38.614 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(5), bloodsoaked_counter(13)
3:39.650 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(4), bloodsoaked_counter(13)
3:40.809 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(3), bloodsoaked_counter(15)
3:42.292 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power, bloodsoaked_counter(18), conch_of_dark_whispers
3:43.466 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers
3:44.612 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(21), conch_of_dark_whispers
3:46.072 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(23), conch_of_dark_whispers
3:47.046 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(24), conch_of_dark_whispers
3:48.506 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(25), conch_of_dark_whispers
3:49.650 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(26), conch_of_dark_whispers
3:50.625 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(26), conch_of_dark_whispers
3:52.085 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(26), conch_of_dark_whispers
3:53.547 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), bloodsoaked_counter(29), conch_of_dark_whispers
3:54.523 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(29), conch_of_dark_whispers
3:55.984 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), bloodsoaked_counter(30), conch_of_dark_whispers
3:56.957 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(4), bloodsoaked_counter(32), conch_of_dark_whispers
3:58.205 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(34), conch_of_dark_whispers
3:59.419 default P stellar_flare Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(35), conch_of_dark_whispers
4:00.631 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(37), conch_of_dark_whispers
4:01.843 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
4:02.942 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
4:04.342 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
4:05.742 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
4:05.742 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse
4:06.641 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse
4:07.700 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse
4:09.008 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse
4:09.882 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), bloodsoaked_counter, conch_of_dark_whispers, ignition_mages_fuse(2)
4:10.781 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), starlord(3), bloodsoaked_counter, ignition_mages_fuse(2)
4:11.837 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2), ignition_mages_fuse(2)
4:13.183 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(4), ignition_mages_fuse(2)
4:14.082 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(5), ignition_mages_fuse(3)
4:15.097 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(6), ignition_mages_fuse(3)
4:16.114 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), bloodsoaked_counter(9), ignition_mages_fuse(3)
4:17.410 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), bloodsoaked_counter(9), ignition_mages_fuse(3)
4:18.518 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(12), ignition_mages_fuse(4)
4:19.420 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(13), ignition_mages_fuse(4)
4:20.322 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(13), ignition_mages_fuse(4)
4:21.076 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(13), ignition_mages_fuse(4)
4:21.955 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(13), ignition_mages_fuse(5)
4:22.710 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), bloodsoaked_counter(14), ignition_mages_fuse(5)
4:23.789 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(15), ignition_mages_fuse(5)
4:24.635 default O moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(16), ignition_mages_fuse(5)
4:25.581 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(18), ignition_mages_fuse(5)
4:26.787 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(18)
4:28.248 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers
4:29.220 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers
4:30.365 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(19), conch_of_dark_whispers
4:31.825 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(20), conch_of_dark_whispers
4:32.718 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(25), bloodsoaked_counter(20), conch_of_dark_whispers
4:33.608 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(24), bloodsoaked_counter(20), conch_of_dark_whispers
4:34.659 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter(22), conch_of_dark_whispers
4:36.002 default N sunfire Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(22), conch_of_dark_whispers
4:37.064 default H blood_of_the_enemy Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked_counter(23), conch_of_dark_whispers
4:38.135 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power seething_rage, arcanic_pulsar(3), solar_empowerment, overwhelming_power(19), bloodsoaked_counter(25), conch_of_dark_whispers
4:39.299 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18), bloodsoaked_counter(26), conch_of_dark_whispers
4:40.433 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(17), bloodsoaked_counter(27), conch_of_dark_whispers
4:41.373 default O moonfire Fluffy_Pillow 19.0/100: 19% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), bloodsoaked_counter(28), conch_of_dark_whispers
4:42.483 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), bloodsoaked_counter(29), conch_of_dark_whispers
4:43.904 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(14), bloodsoaked_counter(30), conch_of_dark_whispers
4:44.854 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), bloodsoaked_counter(30), conch_of_dark_whispers
4:45.975 default P stellar_flare Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), bloodsoaked_counter(30), conch_of_dark_whispers
4:47.072 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(32), conch_of_dark_whispers
4:48.011 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(32), conch_of_dark_whispers
4:49.423 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(32), conch_of_dark_whispers
4:50.840 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(32), conch_of_dark_whispers
4:51.789 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(35), conch_of_dark_whispers
4:52.909 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(37), conch_of_dark_whispers
4:53.865 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(37), conch_of_dark_whispers
4:54.994 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(37), conch_of_dark_whispers
4:56.438 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked, conch_of_dark_whispers
4:57.344 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked
4:58.252 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), lunar_empowerment, torrent_of_elements, bloodsoaked
4:59.416 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, bloodsoaked
5:00.857 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked
5:02.297 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), solar_empowerment, starlord, bloodsoaked
5:03.428 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked
5:04.241 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
5:05.545 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, solar_empowerment, starlord(2), bloodsoaked_counter
5:06.569 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(2)
5:07.416 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2)
5:08.685 default M moonfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), bloodsoaked_counter(3)
5:09.682 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(3)
5:10.829 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(3)
5:11.975 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(3)
5:13.120 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(3)
5:14.463 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(5)
5:15.361 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(5)
5:16.265 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(6)
5:17.330 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(6)
5:18.399 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), overwhelming_power(18), bloodsoaked_counter(6)
5:19.568 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), bloodsoaked_counter(6)
5:21.018 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(15), bloodsoaked_counter(6)
5:22.163 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), bloodsoaked_counter(6)
5:23.589 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(13), bloodsoaked_counter(7)
5:24.544 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(12), bloodsoaked_counter(8)
5:25.502 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(8)
5:26.633 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(9)
5:27.599 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), starlord(2), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(10)
5:28.738 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(10)
5:30.155 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(11)
5:31.277 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(13)
5:32.234 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(14)
5:33.364 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(14)
5:34.497 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(16)
5:35.947 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked_counter(17)
5:36.918 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, bloodsoaked_counter(18)
5:38.065 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, bloodsoaked_counter(18)
5:39.210 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, torrent_of_elements, bloodsoaked_counter(18)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

conflict+strife : 36586 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36586.2 36586.2 25.1 / 0.069% 4311.3 / 11.8% 4443.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
conflict+strife 36586
Heed My Call 304 (434) 0.8% (1.2%) 8.2 32.98sec 15920 0 Direct 8.2 9452 18909 11142 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 91179.15 91179.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 82.12% 9451.77 8901 10236 9451.57 0 10236 63518 63518 0.00
crit 1.46 17.88% 18909.02 17802 20472 14737.77 0 20472 27661 27661 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.4% 8.2 32.98sec 4778 0 Direct 8.2 4051 8102 4778 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 39097.34 39097.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 82.06% 4051.02 3815 4387 4051.27 0 4387 27201 27201 0.00
crit 1.47 17.94% 8101.52 7629 8774 6288.70 0 8774 11896 11896 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5262 14.4% 77.8 3.77sec 20282 15469 Direct 77.8 17208 34381 20282 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.78 77.78 0.00 0.00 1.3112 0.0000 1577492.18 1577492.18 0.00 15468.64 15468.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.86 82.10% 17208.03 8932 22219 17214.87 16574 18063 1098826 1098826 0.00
crit 13.92 17.90% 34381.31 17865 44438 34398.17 31125 38956 478666 478666 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2546 7.0% 14.1 21.41sec 54253 53556 Direct 14.1 2965 5933 3497 17.9%  
Periodic 222.0 2728 5452 3217 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 14.07 221.96 221.96 1.0130 1.3420 763123.76 763123.76 0.00 2444.95 53556.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 82.07% 2964.64 2589 3727 2966.44 2731 3299 34222 34222 0.00
crit 2.52 17.93% 5932.57 5177 7453 5549.46 0 7453 14966 14966 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.1 82.06% 2727.86 11 3470 2728.95 2646 2854 496868 496868 0.00
crit 39.8 17.94% 5452.34 24 6939 5454.81 5098 5862 217068 217068 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 823 2.3% 44.2 6.59sec 5581 0 Direct 44.2 4734 9461 5581 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.22 44.22 0.00 0.00 0.0000 0.0000 246804.69 246804.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.30 82.08% 4733.89 4180 6018 4735.93 4443 5204 171829 171829 0.00
crit 7.92 17.92% 9460.99 8360 12036 9454.91 0 11643 74975 74975 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2957 (4667) 8.1% (12.8%) 94.5 3.12sec 14811 16374 Direct 95.0 7918 15829 9334 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.45 94.97 0.00 0.00 0.9045 0.0000 886451.78 886451.78 0.00 16374.00 16374.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.97 82.10% 7917.67 6967 10030 7921.93 7644 8278 617360 617360 0.00
crit 17.00 17.90% 15828.64 13933 20060 15835.48 14503 17918 269092 269092 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1710 4.7% 74.9 3.93sec 6842 0 Direct 74.9 6842 0 6842 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.90 74.90 0.00 0.00 0.0000 0.0000 512444.27 512444.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.90 100.00% 6842.01 5086 14644 6845.20 5800 8247 512444 512444 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5316.74
  • base_dd_max:5316.74
  • base_dd_mult:1.00
 
Starsurge 12354 33.8% 61.6 4.92sec 60055 57015 Direct 61.4 51069 102100 60242 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.64 61.45 0.00 0.00 1.0533 0.0000 3701798.19 3701798.19 0.00 57014.77 57014.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.40 82.02% 51068.95 45067 64414 51089.31 49319 53562 2574043 2574043 0.00
crit 11.05 17.98% 102099.84 90135 128828 102131.56 92183 118952 1127755 1127755 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1654 4.5% 12.8 23.58sec 38733 37620 Direct 12.8 2513 5029 2959 17.7%  
Periodic 219.6 1768 3535 2084 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 219.62 219.62 1.0297 1.3447 495638.56 495638.56 0.00 1606.67 37619.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 82.27% 2512.94 2231 3213 2513.21 2328 2741 26456 26456 0.00
crit 2.27 17.73% 5029.02 4463 6425 4607.22 0 6425 11408 11408 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.3 82.11% 1768.41 3 2249 1769.16 1715 1846 318909 318909 0.00
crit 39.3 17.89% 3535.14 98 4498 3536.57 3336 3827 138865 138865 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6012 16.4% 90.0 3.11sec 19904 0 Direct 90.0 16895 33798 19904 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.04 90.04 0.00 0.00 0.0000 0.0000 1792163.43 1792163.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.01 82.20% 16894.93 15985 18383 16894.04 16272 17743 1250449 1250449 0.00
crit 16.03 17.80% 33797.83 31970 36765 33797.34 32216 36066 541715 541715 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2834 7.8% 17.9 16.78sec 47566 46347 Direct 17.9 4058 8118 4780 17.8%  
Periodic 221.1 2930 5857 3455 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 221.10 221.10 1.0263 1.3432 849355.54 849355.54 0.00 2693.72 46347.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.68 82.21% 4058.11 3570 5140 4058.54 3803 4465 59572 59572 0.00
crit 3.18 17.79% 8118.17 7141 10281 7844.20 0 10281 25790 25790 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.4 82.06% 2930.19 2 3727 2931.42 2845 3051 531641 531641 0.00
crit 39.7 17.94% 5857.24 32 7453 5859.72 5482 6413 232352 232352 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
conflict+strife
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.67sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.60sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.2 44.0sec 4.9sec 93.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.83%
  • arcanic_pulsar_2:10.28%
  • arcanic_pulsar_3:11.30%
  • arcanic_pulsar_4:10.55%
  • arcanic_pulsar_5:13.78%
  • arcanic_pulsar_6:10.56%
  • arcanic_pulsar_7:10.74%
  • arcanic_pulsar_8:14.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 7.56% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.97% 32.50% 0.0(0.0) 8.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 60.9sec 45.8sec 23.59% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.4 46.3 8.8sec 3.7sec 82.31% 99.73% 1.9(1.9) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.97%
  • lunar_empowerment_2:31.98%
  • lunar_empowerment_3:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.5 64.6sec 34.0sec 47.69% 0.00% 3.5(47.9) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.1 52.2 11.9sec 3.9sec 85.71% 78.98% 0.2(0.2) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.22%
  • solar_empowerment_2:39.86%
  • solar_empowerment_3:17.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.3 20.2sec 4.9sec 97.82% 92.77% 16.1(16.1) 11.5

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.10%
  • starlord_2:22.63%
  • starlord_3:61.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.5 111.8sec 5.4sec 97.73% 0.00% 39.7(39.7) 1.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:50.47

Stack Uptimes

  • strife_1:3.74%
  • strife_2:3.63%
  • strife_3:3.49%
  • strife_4:3.39%
  • strife_5:3.29%
  • strife_6:3.18%
  • strife_7:3.12%
  • strife_8:73.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.5sec 23.63% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
conflict+strife
starsurge Astral Power 61.6 2465.6 40.0 40.0 1501.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.45 763.56 (31.45%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.29%) 40.00 0.00 0.00%
sunfire Astral Power 17.86 53.57 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.22 176.88 (7.28%) 4.00 0.00 0.00%
moonfire Astral Power 14.07 42.20 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.37 (4.22%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.78 933.28 (38.43%) 12.00 0.05 0.01%
natures_balance Astral Power 400.63 200.31 (8.25%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.34 76.06 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.09 8.22
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.77 0.00 70.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data conflict+strife Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data conflict+strife Damage Per Second
Count 7806
Mean 36586.17
Minimum 32934.39
Maximum 40890.12
Spread ( max - min ) 7955.72
Range [ ( max - min ) / 2 * 100% ] 10.87%
Standard Deviation 1132.3562
5th Percentile 34765.44
95th Percentile 38488.98
( 95th Percentile - 5th Percentile ) 3723.54
Mean Distribution
Standard Deviation 12.8165
95.00% Confidence Intervall ( 36561.05 - 36611.29 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3680
0.1 Scale Factor Error with Delta=300 10946
0.05 Scale Factor Error with Delta=300 43784
0.01 Scale Factor Error with Delta=300 1094586
Priority Target DPS
Sample Data conflict+strife Priority Target Damage Per Second
Count 7806
Mean 36586.17
Minimum 32934.39
Maximum 40890.12
Spread ( max - min ) 7955.72
Range [ ( max - min ) / 2 * 100% ] 10.87%
Standard Deviation 1132.3562
5th Percentile 34765.44
95th Percentile 38488.98
( 95th Percentile - 5th Percentile ) 3723.54
Mean Distribution
Standard Deviation 12.8165
95.00% Confidence Intervall ( 36561.05 - 36611.29 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3680
0.1 Scale Factor Error with Delta=300 10946
0.05 Scale Factor Error with Delta=300 43784
0.01 Scale Factor Error with Delta=300 1094586
DPS(e)
Sample Data conflict+strife Damage Per Second (Effective)
Count 7806
Mean 36586.17
Minimum 32934.39
Maximum 40890.12
Spread ( max - min ) 7955.72
Range [ ( max - min ) / 2 * 100% ] 10.87%
Damage
Sample Data conflict+strife Damage
Count 7806
Mean 10955548.89
Minimum 8448177.28
Maximum 13765808.96
Spread ( max - min ) 5317631.68
Range [ ( max - min ) / 2 * 100% ] 24.27%
DTPS
Sample Data conflict+strife Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data conflict+strife Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data conflict+strife Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data conflict+strife Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data conflict+strife Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data conflict+strife Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data conflict+strifeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data conflict+strife Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.86 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 61.64 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.87 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.07 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.99 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.15 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.71 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.22 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPJQPQPJQPMQPNQPQJOJQKJPPPQPQQJQJQJQPQLPPJMPQJOPPJPQQPQQQMJNJPQPOQJQPQPPIJMQJQPJNQPJQPQJOQMPJQPPJNQPQJPPMQQOQJPJQPGQJQLPQJMQPPQQQJJOPPQJQNMPQJQPQPQJPJQOPJMQPJQLPQQQQQJPHEFJMQJQOQPJNQPJQPQPQJQKPJPJQPQJOLPPPQQJMPJPPJQPPJQNOPMQQJPQGJPQQQJPQQQMNQQOQJQPJQPJPJPPMJQPNPQJOPJQPQPJMQPQJPPNQJQPQJOKPPJPQQQQPQNJJPMPQJPQQJPQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask conflict+strife 58.0/100: 58% astral_power
Pre precombat 1 food conflict+strife 58.0/100: 58% astral_power
Pre precombat 2 augmentation conflict+strife 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.251 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.185 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.119 default O stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:04.053 default H celestial_alignment Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:04.865 default F berserking Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:04.865 default G use_items Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect
0:04.865 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife, battle_potion_of_intellect, ignition_mages_fuse
0:05.619 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:06.374 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, strife(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.127 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, strife(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.882 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, strife(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.734 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, strife(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.487 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, strife(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.241 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, strife(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.062 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, strife(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.817 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, strife(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.637 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.392 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.147 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.935 default M sunfire Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.690 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.444 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.233 default N moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.988 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.742 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.724 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.480 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.234 default O stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.990 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.744 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.498 default K sunfire Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, strife(4), ignition_mages_fuse(5)
0:24.252 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, strife(4), ignition_mages_fuse(5)
0:25.007 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, strife(5)
0:26.036 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, strife(5)
0:27.069 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), strife(5)
0:28.106 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(21), strife(6)
0:28.863 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), strife(6)
0:29.904 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20), strife(6)
0:30.659 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(19), strife(6)
0:31.481 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(18), strife(6)
0:32.308 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), strife(6)
0:33.062 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), strife(6)
0:33.817 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), strife(6)
0:34.570 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), strife(6)
0:35.324 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), strife(6)
0:36.077 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(13), strife(6)
0:37.009 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, strife(6)
0:37.764 default L moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, strife(6)
0:38.520 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers, strife(6)
0:39.600 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers, strife(6)
0:40.682 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(2), overwhelming_power(9), conch_of_dark_whispers, strife(6)
0:41.612 default M sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), conch_of_dark_whispers, strife(6)
0:42.788 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7), conch_of_dark_whispers
0:44.292 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(5), conch_of_dark_whispers, strife
0:45.304 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, starlord, overwhelming_power(4), conch_of_dark_whispers, strife
0:46.498 default O stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(3), conch_of_dark_whispers, strife
0:47.663 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers, strife(2)
0:49.153 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(2)
0:50.654 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(3)
0:51.833 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(3)
0:53.293 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(3)
0:54.265 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4)
0:55.239 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(4)
0:56.699 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(5)
0:57.846 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(5)
0:58.992 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(5)
1:00.137 default M sunfire Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(6)
1:01.283 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), torrent_of_elements, conch_of_dark_whispers, strife(6)
1:02.531 default N moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(6)
1:03.745 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(7)
1:04.958 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(7)
1:06.459 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, strife(8)
1:07.461 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8)
1:08.961 default O stellar_flare Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), strife(8)
1:10.138 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), strife(8)
1:11.140 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
1:12.317 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
1:13.290 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), strife(8)
1:14.750 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), strife(8)
1:15.643 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), strife(8)
1:16.985 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), strife(8)
1:18.331 default I cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), strife(8)
1:18.331 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), solar_empowerment(2), torrent_of_elements, overwhelming_power(20), strife(8)
1:19.491 default M sunfire Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(19), strife(8)
1:20.477 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(18), strife(8)
1:21.317 default J starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(17), strife(8)
1:22.308 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(16), strife(8)
1:23.131 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), strife(8)
1:24.366 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), strife(8)
1:25.339 default N moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), strife(8)
1:26.433 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), strife(8)
1:27.364 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), strife(8)
1:28.765 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), strife(8)
1:29.869 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), strife(8)
1:30.812 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), strife(8)
1:32.228 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), strife(8)
1:33.181 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), strife(8)
1:34.307 default O stellar_flare Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), strife(8)
1:35.437 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), strife(8)
1:36.400 default M sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), strife(8)
1:37.538 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, strife(8)
1:38.992 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), strife(8)
1:40.240 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord, strife(8)
1:41.270 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, strife(8)
1:42.815 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, strife(8)
1:44.358 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, strife(8)
1:45.569 default N moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), strife(8)
1:46.746 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), strife(8)
1:47.748 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
1:49.249 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), strife(8)
1:50.251 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), strife(8)
1:51.427 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
1:52.888 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:54.346 default M sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), strife(8)
1:55.491 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), strife(8)
1:56.466 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), strife(8)
1:57.440 default O stellar_flare Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), starlord(3), strife(8)
1:58.586 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), starlord(3), strife(8)
1:59.731 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), strife(8)
2:00.980 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, strife(8)
2:02.525 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, strife(8)
2:03.737 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), strife(8)
2:04.609 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
2:05.914 default G use_items Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, solar_empowerment(3), starlord(2), strife(8)
2:05.914 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, solar_empowerment(3), starlord(2), strife(8), ignition_mages_fuse
2:06.749 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse
2:07.732 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse
2:08.544 default L moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse
2:09.499 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse
2:10.899 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(2)
2:11.796 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse(2)
2:12.853 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(2)
2:13.911 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(2)
2:14.810 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse(3)
2:16.107 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse(3)
2:17.404 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), strife(8), ignition_mages_fuse(3)
2:18.267 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), strife(8), ignition_mages_fuse(4)
2:19.098 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), strife(8), ignition_mages_fuse(4)
2:19.930 default J starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(2), strife(8), ignition_mages_fuse(4)
2:20.996 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, strife(8), ignition_mages_fuse(4)
2:22.031 default O stellar_flare Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse(5)
2:23.003 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse(5)
2:24.239 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8), ignition_mages_fuse(5)
2:25.478 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), strife(8), ignition_mages_fuse(5)
2:26.304 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), strife(8)
2:27.482 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
2:28.455 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:29.600 default M sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:30.745 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:32.204 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), strife(8)
2:33.178 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), strife(8)
2:34.323 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, strife(8)
2:35.297 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
2:36.756 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
2:37.731 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
2:39.189 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, strife(8)
2:40.161 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), torrent_of_elements, strife(8)
2:41.409 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, strife(8)
2:42.954 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, strife(8)
2:44.167 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:45.167 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:46.344 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:47.844 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:49.021 default M sunfire Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:50.018 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:50.866 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:52.136 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:53.133 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:53.980 default L moonfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers, strife(8)
2:54.891 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, strife(8)
2:56.227 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, strife(8)
2:57.124 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, strife(8)
2:58.025 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, strife(8)
2:59.091 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(19), strife(8)
3:00.159 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(18), strife(8)
3:01.233 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar, lunar_empowerment, torrent_of_elements, overwhelming_power(17), strife(8)
3:02.405 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), strife(8)
3:03.861 default H celestial_alignment Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), strife(8)
3:05.052 default E potion Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), strife(8)
3:05.052 default F berserking Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), strife(8), battle_potion_of_intellect
3:05.052 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), strife(8), battle_potion_of_intellect
3:05.967 default M sunfire Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), strife(8), battle_potion_of_intellect
3:06.858 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), strife(8), battle_potion_of_intellect
3:07.617 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), strife(8), battle_potion_of_intellect
3:08.511 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), strife(8), battle_potion_of_intellect
3:09.265 default O stellar_flare Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), strife(8), battle_potion_of_intellect
3:10.143 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), strife(8), battle_potion_of_intellect
3:10.898 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(8), strife(8), battle_potion_of_intellect
3:12.020 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(6), strife(8), battle_potion_of_intellect
3:12.906 default N moonfire Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6), strife(8), battle_potion_of_intellect
3:13.791 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), strife(8), battle_potion_of_intellect
3:14.547 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(4), strife(8), battle_potion_of_intellect
3:15.685 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(3), strife(8), battle_potion_of_intellect
3:16.581 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(2), strife(8), battle_potion_of_intellect
3:17.347 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power, strife(8), battle_potion_of_intellect
3:18.612 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:19.458 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), strife(8), battle_potion_of_intellect
3:20.728 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), strife(8), battle_potion_of_intellect
3:21.726 default J starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), strife(8), battle_potion_of_intellect
3:22.812 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, strife(8), battle_potion_of_intellect
3:23.707 default K sunfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, strife(8), battle_potion_of_intellect
3:24.764 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment(3), starlord, strife(8), battle_potion_of_intellect
3:26.308 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord, strife(8), battle_potion_of_intellect
3:27.521 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), strife(8), battle_potion_of_intellect
3:29.022 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), strife(8), battle_potion_of_intellect
3:30.200 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), strife(8)
3:31.048 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8)
3:32.317 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), strife(8)
3:33.165 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), strife(8)
3:34.162 default O stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8)
3:35.158 default L moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8)
3:36.156 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
3:37.618 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers, strife(8)
3:38.951 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, strife(8)
3:40.288 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, strife(8)
3:41.188 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, strife(8)
3:42.089 default J starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(20), conch_of_dark_whispers, strife(8)
3:43.249 default M sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers, strife(8)
3:44.381 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers, strife(8)
3:45.826 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers, strife(8)
3:46.965 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), conch_of_dark_whispers, strife(8)
3:48.380 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers, strife(8)
3:49.755 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(23), conch_of_dark_whispers, strife(8)
3:50.840 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers, strife(8)
3:51.740 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), strife(8)
3:53.092 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), strife(8)
3:54.453 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(18), strife(8)
3:55.525 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), strife(8)
3:56.440 default N moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), strife(8)
3:57.522 default O stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), strife(8)
3:58.607 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), strife(8)
3:59.994 default M sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(13), strife(8)
4:01.086 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(11), strife(8)
4:02.019 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(10), strife(8)
4:02.957 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(5), overwhelming_power(10), strife(8)
4:04.161 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), strife(8)
4:05.660 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(7), strife(8)
4:06.664 default G use_items Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord, overwhelming_power(6), strife(8)
4:06.664 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord, overwhelming_power(6), strife(8), ignition_mages_fuse
4:07.801 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5), strife(8), ignition_mages_fuse
4:09.217 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(3), strife(8), ignition_mages_fuse
4:10.168 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(2), strife(8), ignition_mages_fuse
4:11.290 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power, strife(8), ignition_mages_fuse(2)
4:12.373 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord(2), strife(8), ignition_mages_fuse(2)
4:13.460 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), strife(8), ignition_mages_fuse(2)
4:14.804 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), strife(8), ignition_mages_fuse(3)
4:15.669 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), starlord(3), strife(8), ignition_mages_fuse(3)
4:16.685 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), starlord(3), strife(8), ignition_mages_fuse(3)
4:17.701 default M sunfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), starlord(3), strife(8), ignition_mages_fuse(3)
4:18.719 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), starlord(3), strife(8), ignition_mages_fuse(4)
4:19.697 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), starlord(3), strife(8), ignition_mages_fuse(4)
4:20.676 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), strife(8), ignition_mages_fuse(4)
4:21.657 default O stellar_flare Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), strife(8), ignition_mages_fuse(4)
4:22.636 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), strife(8), ignition_mages_fuse(4)
4:23.615 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment(2), strife(8), ignition_mages_fuse(5)
4:24.645 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, strife(8), ignition_mages_fuse(5)
4:25.399 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment(3), starlord, strife(8), ignition_mages_fuse(5)
4:26.509 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power celestial_alignment, lunar_empowerment(2), starlord, strife(8), ignition_mages_fuse(5)
4:27.380 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), strife(8)
4:28.251 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), strife(8)
4:29.554 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8)
4:30.579 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
4:32.038 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
4:33.186 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:34.647 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:36.106 default M sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:37.249 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:38.394 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, strife(8)
4:39.369 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:40.828 default N moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, strife(8)
4:41.876 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, strife(8)
4:43.213 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, strife(8)
4:44.112 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, overwhelming_power(21), conch_of_dark_whispers, strife(8)
4:45.269 default O stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(20), strife(8)
4:46.398 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(19), strife(8)
4:47.838 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18), strife(8)
4:48.972 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(17), strife(8)
4:49.914 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), strife(8)
4:51.330 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(25), strife(8)
4:52.246 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), strife(8)
4:53.621 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(23), strife(8)
4:54.704 default M sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), strife(8)
4:55.760 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), strife(8)
4:56.662 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), strife(8)
4:58.021 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(25), strife(8)
4:58.910 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25), strife(8)
4:59.957 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), strife(8)
5:01.295 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), strife(8)
5:02.642 default N moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), strife(8)
5:03.703 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, strife(8)
5:04.609 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, strife(8)
5:05.772 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, strife(8)
5:06.612 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, strife(8)
5:07.873 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, strife(8)
5:08.719 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, strife(8)
5:09.717 default O stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, strife(8)
5:10.690 default K sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, strife(8)
5:11.665 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, strife(8)
5:13.101 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers, strife(8)
5:14.548 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers, strife(8)
5:15.688 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers, strife(8)
5:17.106 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers, strife(8)
5:18.059 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(5), conch_of_dark_whispers, strife(8)
5:19.014 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers, strife(8)
5:20.144 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers, strife(8)
5:21.275 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers, strife(8)
5:22.722 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power, conch_of_dark_whispers, strife(8)
5:23.863 default N moonfire Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(2), starlord(3), conch_of_dark_whispers, strife(8)
5:25.007 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(2), conch_of_dark_whispers, strife(8)
5:26.255 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
5:27.467 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8)
5:28.966 default M sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers, strife(8)
5:30.042 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), strife(8)
5:31.422 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), strife(8)
5:32.348 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, strife(8)
5:33.438 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
5:34.795 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, strife
5:35.706 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, strife
5:36.616 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, strife
5:37.692 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, strife(2)
5:39.068 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, strife(2)
5:39.993 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, strife(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="conflict+strife"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

crucible of flame : 37159 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37158.6 37158.6 25.4 / 0.068% 4410.8 / 11.9% 4691.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.8 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 37159
Ancient Flame 1252 3.4% 24.9 11.78sec 15090 0 Periodic 89.9 3544 7092 4180 18.0% 57.8%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.89 0.00 89.86 89.86 0.0000 1.9314 375653.62 375653.62 0.00 2164.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.7 82.05% 3543.51 2 6423 3523.67 2132 5004 261256 261256 0.00
crit 16.1 17.95% 7091.82 4 12846 7044.06 3547 11639 114397 114397 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1313.31
  • base_td_mult:1.35
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Concentrated Flame 0 (1877) 0.0% (5.1%) 11.5 29.91sec 48991 45299

Stats details: concentrated_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 0.00 0.00 0.00 1.0816 0.0000 0.00 0.00 0.00 45298.98 45298.98
 
 

Action details: concentrated_flame

Static Values
  • id:295373
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295373
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.
 
    Concentrated Flame (_missile) 1136 3.1% 11.5 29.91sec 29645 0 Direct 11.5 25150 50760 29644 17.6%  

Stats details: concentrated_flame_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 11.49 0.00 0.00 0.0000 0.0000 340496.63 340496.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.47 82.45% 25149.64 12753 42084 25116.87 16260 34007 238166 238166 0.00
crit 2.02 17.55% 50759.93 25506 84168 44984.02 0 84168 102331 102331 0.00
 
 

Action details: concentrated_flame_missile

Static Values
  • id:295374
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295374
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11614.19
  • base_dd_max:11614.19
  • base_dd_mult:1.00
 
    Concentrated Flame (_burn) 741 2.0% 11.5 29.91sec 19346 0 Periodic 32.1 6928 0 6928 0.0% 21.4%

Stats details: concentrated_flame_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 0.00 32.07 32.07 0.0000 2.0000 222207.27 222207.27 0.00 3463.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.1 100.00% 6927.75 3347 11047 6925.82 6695 7499 222207 222207 0.00
 
 

Action details: concentrated_flame_burn

Static Values
  • id:295368
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295368
  • name:Concentrated Flame
  • school:fire
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3507.02
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Heed My Call 292 (417) 0.8% (1.1%) 8.2 33.10sec 15351 0 Direct 8.2 9109 18228 10748 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 87598.36 87598.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 82.03% 9108.89 8901 9791 9104.44 0 9791 60900 60900 0.00
crit 1.46 17.97% 18228.48 17802 19582 14204.35 0 19582 26699 26699 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.2 33.10sec 4604 0 Direct 8.2 3904 7809 4604 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 37520.70 37520.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 82.09% 3904.18 3815 4196 3903.78 0 4196 26121 26121 0.00
crit 1.46 17.91% 7808.84 7629 8392 6032.54 0 8392 11399 11399 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4846 13.1% 74.2 3.93sec 19577 14972 Direct 74.2 16598 33199 19577 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.21 74.21 0.00 0.00 1.3076 0.0000 1452820.93 1452820.93 0.00 14972.13 14972.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.89 82.05% 16597.63 8882 21253 16604.88 15965 17513 1010651 1010651 0.00
crit 13.32 17.95% 33198.51 17765 42507 33212.21 29029 38436 442170 442170 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2429 6.5% 14.1 21.27sec 51725 50099 Direct 14.1 2848 5695 3355 17.8%  
Periodic 219.9 2625 5249 3096 17.9% 98.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 14.07 219.92 219.92 1.0325 1.3453 727982.77 727982.77 0.00 2345.44 50098.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.57 82.18% 2847.66 2589 3565 2849.25 2633 3125 32935 32935 0.00
crit 2.51 17.82% 5694.59 5177 7129 5339.39 0 7129 14285 14285 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 82.08% 2625.49 3 3319 2626.74 2549 2741 473942 473942 0.00
crit 39.4 17.92% 5248.70 17 6638 5250.82 4935 5749 206821 206821 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 787 2.1% 43.9 6.60sec 5375 0 Direct 43.9 4557 9109 5375 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.92 43.92 0.00 0.00 0.0000 0.0000 236073.48 236073.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.03 82.03% 4556.64 4180 5756 4558.51 4288 4939 164179 164179 0.00
crit 7.89 17.97% 9109.30 8360 11513 9107.16 0 11513 71894 71894 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2685 (4263) 7.2% (11.5%) 88.7 3.31sec 14400 15962 Direct 89.3 7645 15278 9014 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.74 89.28 0.00 0.00 0.9022 0.0000 804772.88 804772.88 0.00 15961.78 15961.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.27 82.06% 7644.58 6967 9594 7649.36 7351 8102 560112 560112 0.00
crit 16.01 17.94% 15277.72 13933 19188 15288.81 13933 17221 244661 244661 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1578 4.3% 71.7 4.07sec 6598 0 Direct 71.7 6598 0 6598 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.70 71.70 0.00 0.00 0.0000 0.0000 473095.66 473095.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.70 100.00% 6597.89 5086 14007 6601.44 5759 7774 473096 473096 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11456 30.9% 59.3 5.07sec 57899 55001 Direct 59.1 49258 98364 58086 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.29 59.10 0.00 0.00 1.0527 0.0000 3432691.82 3432691.82 0.00 55001.39 55001.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.47 82.02% 49257.76 45067 61614 49280.77 47593 51503 2387611 2387611 0.00
crit 10.62 17.98% 98363.53 90135 123227 98421.66 90135 116703 1045081 1045081 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1575 4.2% 12.7 23.58sec 37160 35570 Direct 12.7 2369 4733 2797 18.1%  
Periodic 217.6 1702 3403 2007 17.9% 97.8%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.71 12.71 217.56 217.56 1.0448 1.3485 472195.36 472195.36 0.00 1539.82 35570.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.40 81.88% 2369.07 2231 3073 2370.13 2231 2563 24650 24650 0.00
crit 2.30 18.12% 4732.82 4463 6146 4332.34 0 6146 10895 10895 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.5 82.06% 1701.93 1 2151 1702.75 1655 1780 303851 303851 0.00
crit 39.0 17.94% 3402.55 70 4302 3404.09 3211 3660 132799 132799 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5551 14.9% 85.8 3.23sec 19282 0 Direct 85.8 16354 32709 19282 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.75 85.75 0.00 0.00 0.0000 0.0000 1653491.13 1653491.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.40 82.09% 16354.01 15985 17583 16353.65 15985 17259 1151275 1151275 0.00
crit 15.35 17.91% 32708.55 31970 35167 32710.84 31970 35167 502216 502216 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2704 7.3% 17.7 16.78sec 45764 44580 Direct 17.7 3905 7806 4608 18.0%  
Periodic 219.1 2821 5637 3326 17.9% 98.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.71 17.71 219.08 219.08 1.0266 1.3467 810289.33 810289.33 0.00 2587.06 44580.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.51 81.96% 3904.72 3570 4917 3905.72 3648 4234 56662 56662 0.00
crit 3.19 18.04% 7805.57 7141 9834 7544.15 0 9834 24936 24936 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.8 82.05% 2820.65 2 3565 2822.02 2737 2940 507046 507046 0.00
crit 39.3 17.95% 5637.44 11 7129 5639.56 5282 6138 221646 221646 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.50sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.42sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8742 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.0 52.1 45.4sec 5.1sec 92.71% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.76%
  • arcanic_pulsar_2:10.61%
  • arcanic_pulsar_3:11.61%
  • arcanic_pulsar_4:10.59%
  • arcanic_pulsar_5:13.45%
  • arcanic_pulsar_6:9.74%
  • arcanic_pulsar_7:10.98%
  • arcanic_pulsar_8:14.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.4sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.5sec 181.5sec 8.11% 8.21% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.1 0.0 38.1sec 38.1sec 25.54% 32.27% 0.0(0.0) 8.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.5sec 45.8sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.10% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.87%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 31.7 45.6 9.5sec 3.9sec 82.44% 99.73% 2.0(2.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.16%
  • lunar_empowerment_2:32.04%
  • lunar_empowerment_3:15.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.5sec 34.1sec 47.57% 0.00% 3.4(47.4) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 23.6 50.5 12.4sec 4.0sec 85.95% 80.45% 0.3(0.3) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.73%
  • solar_empowerment_2:39.97%
  • solar_empowerment_3:18.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.1 44.1 20.3sec 5.1sec 96.82% 92.15% 14.3(14.3) 11.4

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.82%
  • starlord_2:23.10%
  • starlord_3:58.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.71%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starsurge Astral Power 59.3 2371.5 40.0 40.0 1447.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 89.74 717.85 (30.75%) 8.00 0.07 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.43%) 40.00 0.00 0.00%
sunfire Astral Power 17.71 53.12 (2.28%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.92 175.67 (7.53%) 4.00 0.01 0.01%
moonfire Astral Power 14.07 42.22 (1.81%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.71 101.66 (4.35%) 8.00 0.00 0.00%
lunar_strike Astral Power 74.21 890.48 (38.15%) 12.00 0.06 0.01%
natures_balance Astral Power 400.63 200.31 (8.58%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.09 73.04 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.78 7.90
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.70 0.00 77.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data crucible of flame Damage Per Second
Count 7806
Mean 37158.64
Minimum 33209.86
Maximum 41959.00
Spread ( max - min ) 8749.14
Range [ ( max - min ) / 2 * 100% ] 11.77%
Standard Deviation 1142.9767
5th Percentile 35386.76
95th Percentile 39130.63
( 95th Percentile - 5th Percentile ) 3743.87
Mean Distribution
Standard Deviation 12.9367
95.00% Confidence Intervall ( 37133.29 - 37184.00 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3635
0.1 Scale Factor Error with Delta=300 11153
0.05 Scale Factor Error with Delta=300 44609
0.01 Scale Factor Error with Delta=300 1115215
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 7806
Mean 37158.64
Minimum 33209.86
Maximum 41959.00
Spread ( max - min ) 8749.14
Range [ ( max - min ) / 2 * 100% ] 11.77%
Standard Deviation 1142.9767
5th Percentile 35386.76
95th Percentile 39130.63
( 95th Percentile - 5th Percentile ) 3743.87
Mean Distribution
Standard Deviation 12.9367
95.00% Confidence Intervall ( 37133.29 - 37184.00 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3635
0.1 Scale Factor Error with Delta=300 11153
0.05 Scale Factor Error with Delta=300 44609
0.01 Scale Factor Error with Delta=300 1115215
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 7806
Mean 37158.64
Minimum 33209.86
Maximum 41959.00
Spread ( max - min ) 8749.14
Range [ ( max - min ) / 2 * 100% ] 11.77%
Damage
Sample Data crucible of flame Damage
Count 7806
Mean 11126889.94
Minimum 8692922.27
Maximum 13637967.65
Spread ( max - min ) 4945045.38
Range [ ( max - min ) / 2 * 100% ] 22.22%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
H 11.49 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.77 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.29 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.93 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.60 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.47 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.47 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.71 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 74.57 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 88.98 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.30 sunfire

Sample Sequence

0123456789ACDHHKONPIFGKRKRQRQKRQRKRQNRORQRJKRPRQKQQKRHQQRRKNKRQRQRMKQKQPQKRQNRKRQRHQKORQKRQNKPRQRRRRRRKRKRKRMHNQQKPQQRRRRKKQNOQRKRQRKQPHRRRKNGQRKORQKRLQRKQRRQPRKQKQHORNQKRQKRQRRKPQRQKNOQKRQHRQLRKQIEFKRKPRQKORQKRQRQNRQKRKQHQQKPROQNRQRJKRKRKRLQQKQQRKHOPQRQGKNQRKQRRRKQOQPRRRNQKHKRQKRQMQKRQQNRPRKQKRQRRKQHOQKNQRRRKPQQKQRRKNRQKRMQQHKQRQRKQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H concentrated_flame Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default H concentrated_flame Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.213 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:03.175 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.109 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.043 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.979 default I celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.791 default F berserking Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.791 default G use_items Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.791 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:07.547 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:08.302 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:09.057 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:09.810 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:10.600 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:11.355 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.112 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.866 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.619 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.379 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.133 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.889 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.644 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.402 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.155 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.910 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.665 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.418 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.218 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.974 default J cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.974 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.728 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.481 default P stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(5)
0:24.236 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(5)
0:24.992 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(5)
0:25.818 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
0:26.573 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(5)
0:27.502 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
0:28.623 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
0:29.506 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6)
0:30.258 default H concentrated_flame Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5)
0:31.124 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
0:32.231 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
0:33.341 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(2)
0:34.095 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
0:34.848 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power
0:35.726 default N sunfire Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:36.493 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:37.259 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
0:38.013 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:38.990 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:39.744 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:40.723 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:41.478 default M moonfire Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:42.475 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar, lunar_empowerment(2), torrent_of_elements
0:43.723 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements
0:45.267 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
0:46.480 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25)
0:47.849 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
0:48.928 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
0:50.310 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21)
0:51.402 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
0:52.308 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:53.669 default N sunfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18)
0:54.741 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
0:55.656 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
0:56.736 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15)
0:57.658 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:59.046 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12)
0:59.979 default H concentrated_flame Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
1:01.100 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
1:02.507 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(9)
1:03.713 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(8)
1:04.889 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(7)
1:05.893 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(6)
1:07.403 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(4)
1:08.598 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(3)
1:09.588 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2)
1:11.077 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:12.255 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:13.433 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:14.579 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:15.551 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:17.010 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:17.985 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:18.958 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:20.104 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:21.249 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:22.395 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:23.540 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), conch_of_dark_whispers
1:24.788 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:25.684 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:26.738 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
1:27.609 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements
1:28.633 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
1:29.479 default M moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
1:30.476 default H concentrated_flame Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements
1:31.621 default N sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements
1:32.767 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
1:34.104 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
1:35.453 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
1:36.515 default P stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:37.582 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:38.945 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:40.311 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
1:41.230 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:42.154 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:43.202 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:44.250 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), overwhelming_power(23), conch_of_dark_whispers
1:45.399 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), conch_of_dark_whispers
1:46.518 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
1:47.909 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
1:49.002 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
1:50.106 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers
1:51.515 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(16), conch_of_dark_whispers
1:52.460 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers
1:53.575 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
1:54.501 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
1:55.891 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:56.822 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
1:57.920 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:59.325 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
2:00.439 default H concentrated_flame Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
2:01.554 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:02.506 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(5), conch_of_dark_whispers
2:03.463 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:04.591 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), overwhelming_power(3)
2:05.826 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2)
2:07.029 default G use_items Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:07.029 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse
2:08.510 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse
2:09.500 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
2:10.663 default O moonfire Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse
2:11.646 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:12.448 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:13.650 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:14.595 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:15.377 default L sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:16.263 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:17.558 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:18.423 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:19.439 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:20.686 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:21.518 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:22.350 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:23.599 default P stellar_flare Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(5)
2:24.544 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(5)
2:25.489 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), ignition_mages_fuse(5)
2:26.521 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
2:27.794 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, starlord
2:29.005 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:30.507 default H concentrated_flame Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2)
2:31.683 default O moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2)
2:32.861 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2)
2:33.863 default N sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:35.041 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:36.543 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
2:37.719 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:38.693 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:40.153 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
2:41.298 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
2:42.273 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:43.733 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:44.705 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:45.678 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6)
2:46.926 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:48.139 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:49.685 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), solar_empowerment, starlord
2:50.715 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, starlord
2:52.258 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), starlord
2:53.471 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2)
2:54.649 default O moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2)
2:55.825 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2)
2:57.326 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
2:58.502 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:59.350 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
3:00.619 default H concentrated_flame Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, solar_empowerment, starlord(3)
3:01.617 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, solar_empowerment, starlord(3)
3:02.464 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, starlord(3)
3:03.958 default L sunfire Fluffy_Pillow 60.5/100: 61% astral_power celestial_alignment, solar_empowerment, starlord(3)
3:04.954 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power solar_empowerment, starlord(3)
3:05.928 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power
3:07.175 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord
3:08.721 default I celestial_alignment Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord
3:09.777 default E potion Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord
3:09.777 default F berserking Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
3:09.777 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, battle_potion_of_intellect
3:10.735 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), battle_potion_of_intellect
3:11.487 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24), battle_potion_of_intellect
3:12.344 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:13.179 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:13.934 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:14.999 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:15.840 default O moonfire Fluffy_Pillow 11.5/100: 12% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:16.669 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:17.424 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:18.485 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:19.323 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:20.077 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:21.139 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:21.893 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:23.065 default N sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:23.992 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:24.778 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:25.963 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(5), celestial_alignment, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:26.978 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:27.822 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(16), battle_potion_of_intellect
3:28.819 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(15), battle_potion_of_intellect
3:30.239 default H concentrated_flame Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(13), battle_potion_of_intellect
3:31.361 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), battle_potion_of_intellect
3:32.796 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(11), battle_potion_of_intellect
3:34.238 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:35.378 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8)
3:36.489 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7)
3:37.437 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
3:38.559 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
3:39.990 default N sunfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4)
3:41.118 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
3:42.086 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power
3:43.541 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
3:44.512 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
3:44.512 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), torrent_of_elements
3:45.761 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:46.659 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements
3:47.714 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
3:48.586 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements
3:49.611 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
3:50.458 default L sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3)
3:51.454 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3)
3:52.914 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
3:54.370 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
3:55.517 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
3:56.977 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
3:58.436 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
3:59.409 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), starlord(3)
4:00.556 default H concentrated_flame Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
4:01.702 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
4:02.849 default P stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
4:03.995 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
4:05.454 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), solar_empowerment
4:06.516 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment
4:08.106 default G use_items Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4)
4:08.106 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), ignition_mages_fuse
4:09.302 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse
4:10.464 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse
4:11.946 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment, starlord, ignition_mages_fuse
4:12.935 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), starlord, ignition_mages_fuse(2)
4:14.051 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse(2)
4:15.434 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), ignition_mages_fuse(2)
4:16.358 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.404 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.450 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.496 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
4:20.793 default O moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.772 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.020 default P stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:24.000 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:24.830 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.774 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.719 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.665 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:28.871 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(7), torrent_of_elements, conch_of_dark_whispers
4:30.120 default H concentrated_flame Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
4:31.332 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:32.545 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:33.417 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements
4:34.721 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
4:35.746 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
4:36.592 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
4:37.861 default M moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
4:38.859 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
4:40.319 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
4:41.466 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:42.440 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:43.899 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
4:45.359 default N sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3)
4:46.503 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3)
4:47.475 default P stellar_flare Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
4:48.620 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
4:49.594 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(2), solar_empowerment
4:50.843 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord
4:52.389 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord
4:53.601 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2)
4:54.602 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
4:55.980 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
4:56.900 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22)
4:57.824 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21)
4:58.914 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
5:00.274 default H concentrated_flame Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
5:01.346 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
5:02.424 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16)
5:03.799 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15)
5:04.882 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
5:05.972 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
5:07.363 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
5:08.299 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
5:09.238 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(9)
5:10.345 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, torrent_of_elements, overwhelming_power(8)
5:11.559 default P stellar_flare Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7)
5:12.740 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6)
5:14.250 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(4)
5:15.772 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(3)
5:16.971 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2)
5:18.460 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
5:19.461 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements
5:20.462 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(2), torrent_of_elements
5:21.641 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
5:22.639 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
5:23.416 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
5:24.582 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22)
5:25.502 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21)
5:26.288 default M moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20)
5:27.215 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(19)
5:28.575 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(18)
5:29.940 default H concentrated_flame Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord(3), overwhelming_power(17)
5:31.082 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, overwhelming_power(15)
5:32.263 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14)
5:33.730 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(13)
5:34.713 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, starlord, overwhelming_power(12)
5:36.189 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), starlord, overwhelming_power(10)
5:37.358 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), starlord, overwhelming_power(9)
5:38.531 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25)
5:39.901 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

focusing iris : 36687 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36687.0 36687.0 25.2 / 0.069% 4357.6 / 11.9% 4301.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.4 Astral Power 0.00% 60.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 36687
Heed My Call 305 (435) 0.8% (1.2%) 8.5 32.22sec 15329 0 Direct 8.5 9109 18212 10735 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.51 8.51 0.00 0.00 0.0000 0.0000 91385.60 91385.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.99 82.14% 9109.10 8901 9791 9109.04 8901 9791 63692 63692 0.00
crit 1.52 17.86% 18211.65 17802 19582 14396.91 0 19582 27693 27693 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.4% 8.5 32.22sec 4594 0 Direct 8.5 3904 7806 4594 17.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.51 8.51 0.00 0.00 0.0000 0.0000 39109.79 39109.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.01 82.31% 3903.76 3815 4196 3903.59 3815 4196 27352 27352 0.00
crit 1.51 17.69% 7806.30 7629 8392 6138.00 0 8392 11758 11758 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5273 14.4% 80.8 3.64sec 19561 15550 Direct 80.8 16587 33164 19560 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.81 80.81 0.00 0.00 1.2580 0.0000 1580626.48 1580626.48 0.00 15549.69 15549.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.31 82.06% 16586.90 8882 21253 16593.69 16002 17384 1099889 1099889 0.00
crit 14.50 17.94% 33164.46 17765 42507 33179.81 29908 37850 480738 480738 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2551 7.0% 14.2 21.36sec 53953 55084 Direct 14.2 2854 5701 3361 17.8%  
Periodic 231.0 2632 5261 3104 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 230.98 230.98 0.9795 1.2903 764450.97 764450.97 0.00 2450.95 55083.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.65 82.20% 2854.28 2589 3565 2855.68 2614 3125 33242 33242 0.00
crit 2.52 17.80% 5700.58 5177 7129 5317.50 0 7129 14380 14380 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.6 82.07% 2632.20 3 3319 2633.45 2563 2754 498985 498985 0.00
crit 41.4 17.93% 5261.02 3 6638 5263.27 4979 5748 217844 217844 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 828 2.3% 46.0 6.36sec 5389 0 Direct 46.0 4566 9123 5389 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.03 46.03 0.00 0.00 0.0000 0.0000 248062.69 248062.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.71 81.92% 4565.63 4180 5756 4567.70 4310 4953 172160 172160 0.00
crit 8.32 18.08% 9122.97 8360 11513 9125.34 8360 11513 75902 75902 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3009 (4721) 8.2% (12.9%) 99.6 2.96sec 14206 16137 Direct 100.1 7641 15272 9012 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.62 100.11 0.00 0.00 0.8804 0.0000 902166.79 902166.79 0.00 16137.18 16137.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.13 82.04% 7641.48 6967 9594 7646.32 7387 8046 627631 627631 0.00
crit 17.98 17.96% 15271.55 13933 19188 15281.49 13933 17443 274536 274536 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1712 4.7% 77.7 3.78sec 6606 0 Direct 77.7 6606 0 6606 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.67 77.67 0.00 0.00 0.0000 0.0000 513112.43 513112.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.67 100.00% 6606.10 5086 14007 6609.81 5728 7861 513112 513112 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5848.45
  • base_dd_max:5848.45
  • base_dd_mult:1.00
 
Starsurge 12339 33.7% 63.8 4.75sec 57910 57022 Direct 63.6 49279 98470 58095 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.84 63.64 0.00 0.00 1.0156 0.0000 3697064.01 3697064.01 0.00 57021.78 57021.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.23 82.08% 49279.13 45067 61614 49302.86 47412 51884 2573919 2573919 0.00
crit 11.41 17.92% 98469.91 90135 123227 98499.73 90135 112503 1123145 1123145 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1657 4.5% 12.8 23.57sec 38773 39146 Direct 12.8 2428 4861 2862 17.9%  
Periodic 228.6 1706 3409 2012 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.81 12.81 228.63 228.63 0.9905 1.2922 496649.77 496649.77 0.00 1611.91 39146.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.52 82.13% 2427.61 2231 3073 2429.36 2253 2677 25538 25538 0.00
crit 2.29 17.87% 4860.62 4463 6146 4434.84 0 6146 11128 11128 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.6 82.05% 1706.17 2 2151 1707.01 1658 1789 320064 320064 0.00
crit 41.0 17.95% 3409.30 45 4302 3410.78 3213 3694 139920 139920 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6052 16.4% 93.6 3.02sec 19273 0 Direct 93.6 16350 32708 19273 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.62 93.62 0.00 0.00 0.0000 0.0000 1804339.49 1804339.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.89 82.13% 16350.19 15985 17583 16350.14 15985 17238 1257253 1257253 0.00
crit 16.73 17.87% 32708.46 31970 35167 32710.02 31970 34921 547086 547086 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2831 7.7% 17.6 17.07sec 48301 48718 Direct 17.6 3912 7827 4615 18.0%  
Periodic 230.2 2827 5651 3333 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.57 17.57 230.21 230.21 0.9915 1.2904 848421.34 848421.34 0.00 2697.88 48717.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.41 82.03% 3911.65 3570 4917 3913.21 3652 4233 56366 56366 0.00
crit 3.16 17.97% 7827.04 7141 9834 7565.90 0 9834 24699 24699 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.0 82.08% 2827.32 2 3565 2828.72 2744 2957 534239 534239 0.00
crit 41.3 17.92% 5650.83 5 7129 5653.24 5282 6105 233117 233117 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.64sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.45sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8795 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.5 56.1 42.5sec 4.7sec 93.28% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.53%
  • arcanic_pulsar_2:11.27%
  • arcanic_pulsar_3:11.26%
  • arcanic_pulsar_4:10.78%
  • arcanic_pulsar_5:12.79%
  • arcanic_pulsar_6:11.20%
  • arcanic_pulsar_7:11.42%
  • arcanic_pulsar_8:13.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.4sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 8.35% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.0 0.0 39.4sec 39.4sec 26.51% 32.94% 0.0(0.0) 7.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.5sec 23.54% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Energy 1.0 383.2 0.0sec 0.8sec 100.00% 99.73% 376.2(376.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:33.31

Stack Uptimes

  • focused_energy_3:0.42%
  • focused_energy_4:0.31%
  • focused_energy_5:0.41%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.20%
  • focused_energy_10:98.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.4 47.5 8.3sec 3.6sec 81.75% 99.76% 2.1(2.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.94%
  • lunar_empowerment_2:31.15%
  • lunar_empowerment_3:14.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.7 63.7sec 32.9sec 49.22% 0.00% 3.7(51.3) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.52%
  • overwhelming_power_5:1.56%
  • overwhelming_power_6:1.61%
  • overwhelming_power_7:1.65%
  • overwhelming_power_8:1.70%
  • overwhelming_power_9:1.76%
  • overwhelming_power_10:1.81%
  • overwhelming_power_11:1.86%
  • overwhelming_power_12:1.92%
  • overwhelming_power_13:1.98%
  • overwhelming_power_14:2.03%
  • overwhelming_power_15:2.10%
  • overwhelming_power_16:2.16%
  • overwhelming_power_17:2.23%
  • overwhelming_power_18:2.30%
  • overwhelming_power_19:2.37%
  • overwhelming_power_20:2.44%
  • overwhelming_power_21:2.52%
  • overwhelming_power_22:2.59%
  • overwhelming_power_23:2.67%
  • overwhelming_power_24:2.75%
  • overwhelming_power_25:1.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 26.8 53.1 11.2sec 3.8sec 84.72% 77.72% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.19%
  • solar_empowerment_2:39.14%
  • solar_empowerment_3:16.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 48.5 20.2sec 4.7sec 97.93% 93.17% 18.2(18.2) 11.4

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.42%
  • starlord_2:21.96%
  • starlord_3:62.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.3sec 45.8sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.56%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 63.8 2553.7 40.0 40.0 1447.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 100.62 804.92 (31.99%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.18%) 40.00 0.00 0.00%
sunfire Astral Power 17.56 52.69 (2.09%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.03 184.12 (7.32%) 4.00 0.00 0.00%
moonfire Astral Power 14.17 42.51 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.81 102.47 (4.07%) 8.00 0.00 0.00%
lunar_strike Astral Power 80.81 969.60 (38.54%) 12.00 0.07 0.01%
natures_balance Astral Power 400.63 200.32 (7.96%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.62 79.47 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.38 8.51
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.26 0.00 61.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data focusing iris Damage Per Second
Count 7806
Mean 36686.97
Minimum 32887.25
Maximum 41633.40
Spread ( max - min ) 8746.15
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 1133.7953
5th Percentile 34932.25
95th Percentile 38634.33
( 95th Percentile - 5th Percentile ) 3702.08
Mean Distribution
Standard Deviation 12.8328
95.00% Confidence Intervall ( 36661.82 - 36712.12 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3669
0.1 Scale Factor Error with Delta=300 10974
0.05 Scale Factor Error with Delta=300 43895
0.01 Scale Factor Error with Delta=300 1097370
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 7806
Mean 36686.97
Minimum 32887.25
Maximum 41633.40
Spread ( max - min ) 8746.15
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 1133.7953
5th Percentile 34932.25
95th Percentile 38634.33
( 95th Percentile - 5th Percentile ) 3702.08
Mean Distribution
Standard Deviation 12.8328
95.00% Confidence Intervall ( 36661.82 - 36712.12 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3669
0.1 Scale Factor Error with Delta=300 10974
0.05 Scale Factor Error with Delta=300 43895
0.01 Scale Factor Error with Delta=300 1097370
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 7806
Mean 36686.97
Minimum 32887.25
Maximum 41633.40
Spread ( max - min ) 8746.15
Range [ ( max - min ) / 2 * 100% ] 11.92%
Damage
Sample Data focusing iris Damage
Count 7806
Mean 10985389.37
Minimum 8484034.56
Maximum 13657457.55
Spread ( max - min ) 5173422.98
Range [ ( max - min ) / 2 * 100% ] 23.55%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.99 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 63.84 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.57 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.00 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.75 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.17 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.81 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.17 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 99.88 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.25 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPJQPQJQPMQPNQPQJOJQPJPPQQQQQPQJMJQPQPQIJJNPPJQOPQJQPMQPPQQQJJNPPQJQPMOQPQJQPQIJQJPNPJPMQJPQOQQPQJPJPQNMJPQQQJPQPQOQJQJQPGQJKNPPQJPQQQQQQPJJMOPPQJNQPJQPQQPMQJPJOQJQPLPJQPPMQQQQJJPPHEFJQOQJQPNQJMQPQPIJQJQPJQPQJQPQJMONPPPQJPQJQPPJQMPQJQNOPQJPQGPJQPJQPQKQJPPQQNPQJJOPQPJMQPPJQPPQQNJPPJMOPQJQPQPQKPQIJNPPQJQOPJQPQMPIJQJQPJNQPQPQJOQPPQIJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.234 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.159 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.078 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.991 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.780 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.780 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.780 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.536 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.291 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.136 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.890 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.645 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.466 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.221 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.974 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.764 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.519 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.273 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.025 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.788 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.542 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.295 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.057 default N moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.812 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.564 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.373 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.127 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.882 default O stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.635 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.390 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.145 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:23.950 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:24.704 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), ignition_mages_fuse(5)
0:25.543 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10)
0:26.540 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(22), focused_energy(10)
0:27.294 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
0:28.049 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
0:28.804 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(24), focused_energy(10)
0:29.587 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(23), focused_energy(10)
0:30.370 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10)
0:31.370 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(21), focused_energy(10)
0:32.158 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(20), focused_energy(10)
0:32.949 default M sunfire Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), focused_energy(10)
0:33.702 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10)
0:34.459 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
0:35.213 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10)
0:36.096 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
0:36.851 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
0:37.741 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10)
0:38.496 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(25), focused_energy(10)
0:38.496 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, torrent_of_elements, overwhelming_power(25), focused_energy(10)
0:39.250 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), focused_energy(10)
0:40.075 default N moonfire Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), focused_energy(10)
0:40.880 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
0:41.904 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
0:43.241 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
0:44.297 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
0:45.174 default O stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
0:46.207 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
0:47.527 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
0:48.412 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
0:49.455 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
0:50.346 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
0:51.687 default M sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
0:52.743 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
0:53.644 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
0:54.997 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers
0:56.355 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10)
0:57.266 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10)
0:58.181 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(5), focused_energy(10)
0:59.263 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(5), lunar_empowerment, overwhelming_power(4), focused_energy(10)
1:00.445 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), focused_energy(10)
1:01.516 default N moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
1:02.560 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10)
1:03.896 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
1:05.235 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(19), focused_energy(10)
1:06.136 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), focused_energy(10)
1:07.199 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), focused_energy(10)
1:08.081 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10)
1:09.406 default M sunfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
1:10.450 default O stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
1:11.497 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
1:12.389 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
1:13.732 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
1:14.633 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
1:15.696 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers
1:16.484 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10), conch_of_dark_whispers
1:17.669 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers
1:18.463 default I cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power celestial_alignment, starlord(3), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
1:18.463 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power celestial_alignment, overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
1:19.485 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), focused_energy(10), conch_of_dark_whispers
1:20.331 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(4), focused_energy(10), conch_of_dark_whispers
1:21.329 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(3), focused_energy(10), conch_of_dark_whispers
1:22.755 default N moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
1:23.879 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power, focused_energy(10), conch_of_dark_whispers
1:25.317 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment, starlord(2), focused_energy(10)
1:26.450 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:27.851 default M sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10)
1:28.952 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10)
1:29.888 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10)
1:30.990 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:32.394 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), focused_energy(10)
1:33.331 default O stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10)
1:34.433 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10)
1:35.368 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10)
1:36.304 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), focused_energy(10)
1:37.706 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), starlord(3), focused_energy(10)
1:38.808 default J starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(4), focused_energy(10)
1:40.008 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), focused_energy(10)
1:41.373 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(24), focused_energy(10)
1:42.444 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
1:43.776 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10)
1:44.667 default N moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10)
1:45.720 default M sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10)
1:46.776 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
1:47.835 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
1:49.151 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
1:50.035 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
1:50.922 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
1:51.968 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
1:53.015 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
1:54.358 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
1:55.258 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
1:56.609 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10), conch_of_dark_whispers
1:57.675 default O stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10), conch_of_dark_whispers
1:58.745 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(7), focused_energy(10), conch_of_dark_whispers
1:59.819 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
2:00.993 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), focused_energy(10)
2:01.783 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), focused_energy(10)
2:02.717 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), focused_energy(10)
2:03.489 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), focused_energy(10)
2:04.651 default G use_items Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10)
2:04.651 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10), ignition_mages_fuse
2:05.534 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10), ignition_mages_fuse
2:06.417 default K sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), ignition_mages_fuse
2:07.282 default N moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), ignition_mages_fuse
2:08.276 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10), ignition_mages_fuse
2:09.549 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10), ignition_mages_fuse(2)
2:10.779 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10), ignition_mages_fuse(2)
2:11.601 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(14), focused_energy(10), ignition_mages_fuse(2)
2:12.574 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10), ignition_mages_fuse(2)
2:13.817 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10), ignition_mages_fuse(3)
2:14.622 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(11), focused_energy(10), ignition_mages_fuse(3)
2:15.571 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(10), focused_energy(10), ignition_mages_fuse(3)
2:16.521 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(9), focused_energy(10), ignition_mages_fuse(3)
2:17.472 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(8), focused_energy(10), ignition_mages_fuse(4)
2:18.397 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(7), focused_energy(10), ignition_mages_fuse(4)
2:19.325 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10), ignition_mages_fuse(4)
2:20.509 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), overwhelming_power(5), focused_energy(10), ignition_mages_fuse(4)
2:21.525 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), focused_energy(10), ignition_mages_fuse(5)
2:22.481 default M sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3), focused_energy(10), ignition_mages_fuse(5)
2:23.413 default O stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), focused_energy(10), ignition_mages_fuse(5)
2:24.348 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, focused_energy(10), ignition_mages_fuse(5)
2:25.543 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
2:26.985 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), focused_energy(10)
2:27.948 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), focused_energy(10)
2:29.082 default N moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:30.181 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:31.116 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
2:32.519 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10)
2:33.620 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:34.557 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
2:35.958 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), focused_energy(10)
2:36.897 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), focused_energy(10)
2:37.833 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), focused_energy(10)
2:39.236 default M sunfire Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10)
2:40.336 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10)
2:41.438 default J starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(7), focused_energy(10)
2:42.638 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
2:44.123 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment, starlord, focused_energy(10)
2:45.288 default O stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
2:46.271 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
2:47.108 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
2:48.092 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:48.905 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
2:50.126 default L moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:51.083 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:52.487 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
2:53.588 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers
2:54.447 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
2:55.736 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
2:57.032 default M sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
2:58.054 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
2:58.916 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
2:59.778 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
3:00.642 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(25), focused_energy(10)
3:01.651 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(24), focused_energy(10)
3:02.755 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), focused_energy(10)
3:03.831 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10)
3:05.166 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), focused_energy(10)
3:06.493 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
3:07.403 default E potion Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
3:07.403 default F berserking Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:07.403 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:08.233 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:08.988 default O stellar_flare Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:09.798 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:10.552 default J starsurge Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:11.352 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:12.105 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:13.132 default N moonfire Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:13.942 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:14.697 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:15.508 default M sunfire Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:16.322 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:17.076 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:18.122 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:18.877 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:19.896 default I cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:19.896 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:20.854 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:21.652 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:22.591 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect
3:23.369 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(20), focused_energy(10), battle_potion_of_intellect
3:24.540 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect
3:25.462 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), battle_potion_of_intellect
3:26.226 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), focused_energy(10), battle_potion_of_intellect
3:27.374 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), battle_potion_of_intellect
3:28.280 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), battle_potion_of_intellect
3:29.190 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10), battle_potion_of_intellect
3:29.965 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), focused_energy(10), battle_potion_of_intellect
3:31.126 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10), battle_potion_of_intellect
3:31.882 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10), battle_potion_of_intellect
3:32.759 default M sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
3:33.772 default O stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10)
3:34.788 default N moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10)
3:35.808 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10)
3:37.109 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10)
3:38.420 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
3:39.736 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10)
3:40.619 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, overwhelming_power(16), focused_energy(10)
3:41.753 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(15), focused_energy(10)
3:43.161 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(13), focused_energy(10)
3:44.106 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(12), focused_energy(10)
3:45.223 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(11), focused_energy(10)
3:46.148 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10)
3:47.540 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), focused_energy(10)
3:48.936 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), focused_energy(10)
3:50.037 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6), focused_energy(10)
3:50.954 default M sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), focused_energy(10)
3:52.031 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10)
3:53.412 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3), focused_energy(10)
3:54.338 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10)
3:55.432 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10)
3:56.366 default N moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:57.467 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:58.568 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
3:59.970 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
4:00.905 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, torrent_of_elements, focused_energy(10)
4:02.104 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, focused_energy(10)
4:03.587 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
4:04.576 default G use_items Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(25), focused_energy(10)
4:04.576 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(25), focused_energy(10), ignition_mages_fuse
4:05.888 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(25), focused_energy(10), ignition_mages_fuse
4:06.916 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24), focused_energy(10), ignition_mages_fuse
4:07.671 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10), ignition_mages_fuse
4:08.787 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10), ignition_mages_fuse(2)
4:09.635 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), ignition_mages_fuse(2)
4:10.391 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), ignition_mages_fuse(2)
4:11.448 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(19), focused_energy(10), ignition_mages_fuse(2)
4:12.201 default K sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), ignition_mages_fuse(2)
4:13.038 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), ignition_mages_fuse(3)
4:13.828 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10), ignition_mages_fuse(3)
4:14.758 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), ignition_mages_fuse(3)
4:15.946 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), ignition_mages_fuse(3)
4:17.138 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10), ignition_mages_fuse(4)
4:17.913 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10), ignition_mages_fuse(4)
4:18.686 default N moonfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10), ignition_mages_fuse(4)
4:19.600 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(11), focused_energy(10), ignition_mages_fuse(4)
4:20.765 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(10), focused_energy(10), ignition_mages_fuse(5)
4:21.651 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(9), focused_energy(10), ignition_mages_fuse(5)
4:22.623 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), focused_energy(10), ignition_mages_fuse(5)
4:23.568 default O stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(7), focused_energy(10), ignition_mages_fuse(5)
4:24.489 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(6), focused_energy(10), ignition_mages_fuse(5)
4:25.666 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(5), focused_energy(10)
4:26.610 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), focused_energy(10)
4:28.031 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), focused_energy(10)
4:29.156 default M sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, focused_energy(10)
4:30.254 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
4:31.191 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:32.594 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:33.997 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:35.099 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
4:36.035 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:37.439 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:38.843 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:39.780 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
4:40.717 default N moonfire Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
4:41.817 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, focused_energy(10), conch_of_dark_whispers
4:43.016 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:44.500 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:45.982 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:47.146 default M sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
4:48.276 default O stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
4:49.408 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
4:50.851 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), focused_energy(10)
4:51.811 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10)
4:52.944 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
4:53.757 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
4:54.976 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
4:55.790 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10)
4:57.009 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
4:57.824 default K sunfire Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10)
4:58.782 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lunar_empowerment(2), starlord(3), focused_energy(10)
5:00.186 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power lunar_empowerment, starlord(3), focused_energy(10)
5:01.287 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power lunar_empowerment(2), starlord(3), focused_energy(10)
5:01.287 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power lunar_empowerment(2), focused_energy(10)
5:02.486 default N moonfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord, focused_energy(10)
5:03.649 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord, focused_energy(10)
5:05.132 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10)
5:06.615 default Q solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
5:07.607 default J starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
5:08.772 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
5:09.735 default O stellar_flare Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
5:10.870 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
5:12.312 default J starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
5:13.446 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
5:14.383 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
5:15.787 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
5:16.723 default M sunfire Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
5:17.824 default P lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
5:19.228 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10)
5:19.228 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(3), solar_empowerment(2), overwhelming_power(25), focused_energy(10)
5:20.328 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(24), focused_energy(10)
5:21.240 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23), focused_energy(10)
5:22.316 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), focused_energy(10)
5:23.206 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
5:24.545 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), focused_energy(10)
5:25.599 default N moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10)
5:26.630 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10)
5:27.509 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
5:28.830 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10)
5:29.715 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10)
5:31.045 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10)
5:31.939 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10)
5:32.989 default O stellar_flare Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
5:34.045 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
5:34.949 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
5:36.304 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
5:37.668 default Q solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
5:38.529 default I cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
5:38.529 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), solar_empowerment, torrent_of_elements, overwhelming_power(23), focused_energy(10)
5:39.638 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(24), focused_energy(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

life-force : 39270 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39270.0 39270.0 30.8 / 0.078% 5312.2 / 13.5% 4528.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.1 Astral Power 0.00% 58.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 39270
Azerite Spike 742 1.9% 16.9 17.05sec 13146 0 Direct 16.9 11153 22300 13160 18.0%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.91 16.89 0.00 0.00 0.0000 0.0000 222275.79 222275.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.85 82.00% 11153.04 10657 12308 11149.63 10695 11995 154471 154471 0.00
crit 3.04 18.00% 22299.73 21313 24617 21216.28 0 24617 67805 67805 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9704.69
  • base_dd_max:9704.69
  • base_dd_mult:1.00
 
Heed My Call 306 (438) 0.8% (1.1%) 8.3 32.81sec 15723 0 Direct 8.3 9325 18637 11011 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.34 8.34 0.00 0.00 0.0000 0.0000 91838.25 91838.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 81.89% 9324.87 8901 10280 9323.25 0 10280 63685 63685 0.00
crit 1.51 18.11% 18636.82 17802 20561 14737.41 0 20561 28153 28153 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 131 0.3% 8.3 32.81sec 4711 0 Direct 8.3 3996 7993 4712 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.34 8.34 0.00 0.00 0.0000 0.0000 39294.70 39294.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.85 82.09% 3995.78 3815 4406 3996.37 3815 4406 27358 27358 0.00
crit 1.49 17.91% 7992.62 7629 8812 6218.72 0 8812 11937 11937 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5217 13.3% 78.0 3.75sec 20046 15527 Direct 78.0 16990 33965 20046 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.01 78.01 0.00 0.00 1.2910 0.0000 1563734.48 1563734.48 0.00 15527.41 15527.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.97 82.00% 16990.09 8882 22316 16999.17 16281 17843 1086803 1086803 0.00
crit 14.04 18.00% 33965.03 17765 44632 33984.44 30675 40234 476931 476931 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2570 6.6% 14.0 21.39sec 54847 54429 Direct 14.0 2918 5838 3445 18.0%  
Periodic 226.1 2705 5407 3191 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 226.12 226.12 1.0077 1.3131 769957.99 769957.99 0.00 2475.25 54429.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.50 81.95% 2918.23 2589 3743 2920.25 2666 3230 33573 33573 0.00
crit 2.53 18.05% 5837.50 5177 7486 5472.79 0 7486 14790 14790 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.4 82.01% 2705.07 7 3485 2706.72 2618 2834 501598 501598 0.00
crit 40.7 17.99% 5406.93 8 6970 5409.62 5025 6004 219998 219998 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 832 2.1% 45.0 6.48sec 5538 0 Direct 45.0 4693 9376 5538 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.99 44.99 0.00 0.00 0.0000 0.0000 249139.82 249139.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.87 81.96% 4693.43 4180 6044 4696.17 4364 5169 173049 173049 0.00
crit 8.12 18.04% 9376.05 8360 12088 9373.87 0 11773 76091 76091 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2951 (4651) 7.5% (11.9%) 95.0 3.10sec 14666 16308 Direct 95.5 7851 15682 9256 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.03 95.54 0.00 0.00 0.8993 0.0000 884216.17 884216.17 0.00 16308.08 16308.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.40 82.07% 7851.14 6967 10073 7857.29 7527 8469 615556 615556 0.00
crit 17.13 17.93% 15681.72 13933 20147 15692.35 14123 18104 268660 268660 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1700 4.3% 75.2 3.89sec 6778 0 Direct 75.2 6778 0 6778 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.18 75.18 0.00 0.00 0.0000 0.0000 509570.07 509570.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.18 100.00% 6777.76 5086 14707 6782.29 5921 7980 509570 509570 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 12276 31.3% 61.9 4.87sec 59405 57196 Direct 61.7 50523 101000 59594 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.91 61.72 0.00 0.00 1.0386 0.0000 3677971.33 3677971.33 0.00 57195.73 57195.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.63 82.03% 50523.25 45067 64694 50551.88 48349 53078 2557907 2557907 0.00
crit 11.09 17.97% 100999.76 90135 129389 101041.99 90135 117607 1120064 1120064 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1667 4.3% 12.8 23.57sec 39136 38416 Direct 12.8 2486 4967 2927 17.8%  
Periodic 223.7 1752 3502 2066 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 223.69 223.69 1.0188 1.3164 499405.76 499405.76 0.00 1624.31 38415.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 82.24% 2486.36 2231 3227 2487.45 2281 2795 26094 26094 0.00
crit 2.27 17.76% 4966.66 4463 6453 4541.22 0 6453 11254 11254 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.6 82.10% 1752.46 8 2259 1753.51 1699 1833 321834 321834 0.00
crit 40.0 17.90% 3501.82 17 4517 3503.95 3268 3854 140224 140224 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6207 15.7% 92.5 3.01sec 19994 0 Direct 92.5 16951 33901 19994 18.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.51 92.51 0.00 0.00 0.0000 0.0000 1849648.67 1849648.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.90 82.05% 16951.09 15985 18463 16952.21 16420 17942 1286588 1286588 0.00
crit 16.61 17.95% 33901.17 31970 36925 33900.44 32369 36765 563061 563061 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2862 7.3% 18.0 16.64sec 47738 47101 Direct 18.0 4022 8048 4751 18.1%  
Periodic 225.2 2905 5806 3429 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 225.24 225.24 1.0135 1.3143 857609.13 857609.13 0.00 2729.10 47100.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.71 81.89% 4021.67 3570 5163 4022.83 3683 4418 59166 59166 0.00
crit 3.25 18.11% 8047.85 7141 10325 7791.08 0 10325 26182 26182 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.6 81.96% 2905.43 2 3743 2907.17 2813 3049 536388 536388 0.00
crit 40.6 18.04% 5805.63 6 7486 5809.21 5376 6343 235873 235873 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
pet - guardian_of_azeroth 8920 / 1808
Azerite Spike 7901 4.0% 58.2 3.64sec 8145 8066 Direct 58.2 6927 13853 8146 17.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.20 58.20 0.00 0.00 1.0099 0.0000 474085.81 474085.81 0.00 8065.56 8065.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.96 82.41% 6926.52 6927 6927 6926.52 6927 6927 332221 332221 0.00
crit 10.24 17.59% 13853.04 13853 13853 13853.04 13853 13853 141865 141865 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6308.05
  • base_dd_max:6308.05
  • base_dd_mult:1.00
 
Azerite Volley 1019 0.5% 6.0 39.27sec 10189 0 Direct 6.0 8658 17316 10190 17.7%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 61133.89 61133.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.94 82.32% 8658.15 8658 8658 8658.15 8658 8658 42764 42764 0.00
crit 1.06 17.68% 17316.29 17316 17316 11985.64 0 17316 18370 18370 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7884.76
  • base_dd_max:7884.76
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.45sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8526 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 0.00sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.1805 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.4 43.6sec 4.9sec 92.69% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.81%
  • arcanic_pulsar_2:10.99%
  • arcanic_pulsar_3:10.92%
  • arcanic_pulsar_4:10.56%
  • arcanic_pulsar_5:13.49%
  • arcanic_pulsar_6:11.07%
  • arcanic_pulsar_7:10.60%
  • arcanic_pulsar_8:13.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.3sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 12.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.9sec 37.9sec 26.02% 33.64% 0.0(0.0) 8.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.7sec 23.74% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Guardian of Azeroth 2.0 56.2 180.2sec 3.6sec 19.21% 0.00% 48.2(48.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.91%
  • guardian_of_azeroth_2:0.90%
  • guardian_of_azeroth_3:0.88%
  • guardian_of_azeroth_4:0.79%
  • guardian_of_azeroth_5:15.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.18% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.8 46.3 8.7sec 3.7sec 81.90% 99.68% 2.0(2.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.40%
  • lunar_empowerment_2:31.22%
  • lunar_empowerment_3:14.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.1sec 33.6sec 48.14% 0.00% 3.5(49.7) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.4 52.1 11.7sec 3.9sec 84.93% 78.82% 0.2(0.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.48%
  • solar_empowerment_2:39.27%
  • solar_empowerment_3:17.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 46.7 20.2sec 4.9sec 97.34% 93.68% 16.6(16.6) 11.4

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.34%
  • starlord_2:22.44%
  • starlord_3:60.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.6sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starsurge Astral Power 61.9 2476.5 40.0 40.0 1485.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.03 768.21 (31.50%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
sunfire Astral Power 17.96 53.89 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.98 179.93 (7.38%) 4.00 0.01 0.00%
moonfire Astral Power 14.04 42.11 (1.73%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.09 (4.19%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.01 936.03 (38.38%) 12.00 0.08 0.01%
natures_balance Astral Power 400.63 200.31 (8.21%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.37 76.43 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.13 8.25
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.67 0.00 65.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data life-force Damage Per Second
Count 7806
Mean 39269.98
Minimum 35291.67
Maximum 45549.81
Spread ( max - min ) 10258.14
Range [ ( max - min ) / 2 * 100% ] 13.06%
Standard Deviation 1389.0725
5th Percentile 37092.23
95th Percentile 41621.08
( 95th Percentile - 5th Percentile ) 4528.85
Mean Distribution
Standard Deviation 15.7221
95.00% Confidence Intervall ( 39239.17 - 39300.79 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4807
0.1 Scale Factor Error with Delta=300 16472
0.05 Scale Factor Error with Delta=300 65887
0.01 Scale Factor Error with Delta=300 1647152
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 7806
Mean 39269.98
Minimum 35291.67
Maximum 45549.81
Spread ( max - min ) 10258.14
Range [ ( max - min ) / 2 * 100% ] 13.06%
Standard Deviation 1389.0725
5th Percentile 37092.23
95th Percentile 41621.08
( 95th Percentile - 5th Percentile ) 4528.85
Mean Distribution
Standard Deviation 15.7221
95.00% Confidence Intervall ( 39239.17 - 39300.79 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4807
0.1 Scale Factor Error with Delta=300 16472
0.05 Scale Factor Error with Delta=300 65887
0.01 Scale Factor Error with Delta=300 1647152
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 7806
Mean 39269.98
Minimum 35291.67
Maximum 45549.81
Spread ( max - min ) 10258.14
Range [ ( max - min ) / 2 * 100% ] 13.06%
Damage
Sample Data life-force Damage
Count 7806
Mean 11214662.16
Minimum 8693438.14
Maximum 13824804.47
Spread ( max - min ) 5131366.34
Range [ ( max - min ) / 2 * 100% ] 22.88%
DTPS
Sample Data life-force Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 2.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.91 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.91 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.97 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.86 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.49 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.17 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 78.37 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 95.29 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.51 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRKRQRNRORQRSKPKRLQQKRQRQRRQKRKRQRQRMJKKNQPQKRQQKRQQRRNKKOQRQKPRQRRQRNRJKRKRKRQOQKQRPKRNQQRKQRKOQQRKQRNRRPRRKKRGRQKRMQQKNQRRRQRRRKKPQQRKONRQKRQQRRRKQKPQNRKRQRKRQOQHRRKQIEFKNRKPRQRORQKRQRQJKRKRQKLQQQRRQPKORQJKRKNQKRQQRKRQRRQOPKNKQGRQQRKRQKRQQNORKPRKRQRKQQQKRQQNRQRKKOQPRQKRQRKNQRQRKQORKRQKPRLQKQRRQRKQKORQRNKQRRKQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H guardian_of_azeroth Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.212 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.127 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.025 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.921 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.688 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.688 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.688 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.441 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.195 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.950 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.705 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.480 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.234 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.987 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.742 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.496 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.249 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.004 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.757 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.514 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.268 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.023 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.779 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.534 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.288 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.042 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.795 default S sunfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.550 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.304 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.060 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
0:23.814 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.568 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.321 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.130 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers
0:27.100 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
0:27.865 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:28.619 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:29.569 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:30.322 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:31.375 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:32.128 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:32.882 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:33.941 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:34.776 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:35.529 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:36.285 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:37.040 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:37.978 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:38.732 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:39.675 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:40.428 default M moonfire Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:41.183 default J cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:41.183 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(7), conch_of_dark_whispers
0:42.400 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(6), conch_of_dark_whispers
0:43.584 default N sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
0:44.741 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers
0:46.219 default P stellar_flare Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
0:47.388 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, conch_of_dark_whispers
0:48.881 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:50.059 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:51.033 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:52.492 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:53.952 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:55.097 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:56.070 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:57.530 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:58.990 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:59.965 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
1:00.939 default N sunfire Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
1:02.085 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(5), torrent_of_elements
1:03.332 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:04.544 default O moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:05.722 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:07.223 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:08.225 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:09.725 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements
1:10.902 default P stellar_flare Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
1:12.047 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
1:13.019 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:14.479 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements
1:15.453 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:16.428 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3)
1:17.888 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:18.863 default N sunfire Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3)
1:20.009 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3)
1:21.156 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3)
1:21.156 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8)
1:22.405 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:23.302 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord
1:24.358 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24)
1:25.157 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(23)
1:26.102 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22)
1:26.886 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22)
1:28.059 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20)
1:29.126 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19)
1:30.486 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
1:31.557 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17)
1:32.928 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16)
1:33.846 default P stellar_flare Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
1:34.930 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
1:36.018 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12)
1:36.951 default N sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
1:38.048 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
1:39.452 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
1:40.863 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8)
1:41.807 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), solar_empowerment, overwhelming_power(7)
1:43.025 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(5)
1:44.540 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(4)
1:45.554 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3)
1:46.753 default O moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2)
1:47.922 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power
1:49.417 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
1:50.917 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
1:51.918 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
1:53.096 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:54.556 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:55.529 default N sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:56.675 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:57.647 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), starlord(3)
1:58.794 default P stellar_flare Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), starlord(3)
1:59.938 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), starlord(3)
2:01.083 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), starlord(3)
2:02.229 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7)
2:03.478 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:04.691 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:05.562 default G use_items Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
2:05.562 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse
2:06.399 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), ignition_mages_fuse
2:07.650 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment, starlord(2), ignition_mages_fuse
2:08.632 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse
2:09.446 default M moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), ignition_mages_fuse
2:10.405 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(2)
2:11.645 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(23), ignition_mages_fuse(2)
2:12.889 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(2)
2:13.870 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(3)
2:14.819 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(3)
2:16.032 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(3)
2:16.847 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(3)
2:17.664 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(4)
2:18.594 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(4)
2:19.780 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(4)
2:20.714 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(14), ignition_mages_fuse(4)
2:21.651 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(5)
2:22.560 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), lunar_empowerment, torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(5)
2:23.555 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(5)
2:24.522 default P stellar_flare Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
2:25.466 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(5)
2:26.672 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
2:28.128 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
2:29.106 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
2:30.261 default O moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:31.388 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:32.521 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:33.489 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
2:34.943 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:36.088 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:37.060 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:38.519 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:39.979 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:40.953 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
2:41.926 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
2:43.071 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), overwhelming_power(24), conch_of_dark_whispers
2:44.218 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), conch_of_dark_whispers
2:45.638 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(22), conch_of_dark_whispers
2:46.757 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
2:47.847 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
2:49.242 default N sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers
2:50.345 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers
2:51.286 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(16), conch_of_dark_whispers
2:52.395 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
2:53.198 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
2:54.404 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
2:55.213 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
2:56.168 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:56.983 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:58.202 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9)
2:59.312 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8)
3:00.728 default H guardian_of_azeroth Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(7)
3:01.845 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(6)
3:02.797 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power guardian_of_azeroth, arcanic_pulsar, starlord(3), overwhelming_power(5)
3:03.898 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power guardian_of_azeroth(2), arcanic_pulsar, overwhelming_power(4)
3:05.080 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power guardian_of_azeroth(2), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2)
3:06.553 default I celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power
3:07.544 default E potion Fluffy_Pillow 86.0/100: 86% astral_power guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord
3:07.544 default F berserking Fluffy_Pillow 86.0/100: 86% astral_power guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:07.544 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power berserking, guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:08.432 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:09.280 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:10.034 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:10.883 default P stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:11.708 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:12.461 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:13.511 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:14.265 default O moonfire Fluffy_Pillow 61.5/100: 62% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.087 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.840 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.889 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:17.643 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:18.396 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:19.363 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:20.118 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:21.188 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:21.188 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:22.106 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:22.865 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:23.762 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:24.515 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(17), battle_potion_of_intellect
3:25.628 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(16), battle_potion_of_intellect
3:26.507 default L sunfire Fluffy_Pillow 8.5/100: 9% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:27.364 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:28.626 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:29.890 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:31.159 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:32.098 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:33.206 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(8)
3:34.623 default P stellar_flare Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(7)
3:35.740 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6)
3:36.861 default O moonfire Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5)
3:37.839 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4)
3:38.673 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3)
3:39.930 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(2)
3:39.930 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power celestial_alignment, torrent_of_elements, overwhelming_power(2)
3:41.006 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:41.902 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, torrent_of_elements
3:42.956 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
3:44.135 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
3:45.636 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:46.814 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
3:47.788 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:49.247 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:50.706 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), torrent_of_elements
3:51.681 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:52.827 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:53.801 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
3:55.261 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
3:56.234 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
3:57.207 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
3:58.666 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), starlord(3)
3:59.809 default P stellar_flare Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(4), starlord(3)
4:00.955 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(4)
4:02.205 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
4:03.418 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
4:04.632 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:06.133 default G use_items Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2)
4:06.133 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse
4:07.094 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse
4:08.534 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
4:09.973 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), ignition_mages_fuse
4:10.934 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:12.018 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:12.914 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:14.259 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:15.274 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:16.140 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:17.435 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:18.729 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:19.709 default O moonfire Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:20.687 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:21.520 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, ignition_mages_fuse(4)
4:22.588 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, ignition_mages_fuse(5)
4:23.459 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, ignition_mages_fuse(5)
4:24.214 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, ignition_mages_fuse(5)
4:25.084 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
4:25.839 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
4:26.917 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
4:27.789 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
4:28.814 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24)
4:30.152 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22)
4:31.496 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
4:32.835 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
4:33.889 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
4:34.790 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
4:36.142 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
4:37.505 default N sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(18)
4:38.578 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(17)
4:39.494 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16)
4:40.871 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(15)
4:41.792 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), overwhelming_power(14)
4:42.980 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
4:44.136 default O moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
4:45.267 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
4:46.714 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(9)
4:47.852 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8)
4:48.823 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
4:50.286 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(5)
4:51.441 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4)
4:52.401 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
4:53.845 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(2)
4:54.812 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power
4:55.953 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
4:57.098 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
4:58.558 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
4:59.531 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
5:00.991 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
5:01.965 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), solar_empowerment
5:03.213 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
5:04.758 default O moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, conch_of_dark_whispers
5:05.971 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, conch_of_dark_whispers
5:07.002 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, conch_of_dark_whispers
5:08.215 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:09.086 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
5:10.391 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers
5:11.416 default P stellar_flare Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:12.411 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:13.259 default L sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
5:14.257 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
5:15.716 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers
5:16.860 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:18.318 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
5:19.291 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
5:20.265 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
5:21.725 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements
5:22.870 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), torrent_of_elements
5:24.117 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
5:25.662 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
5:26.873 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:28.051 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:29.051 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:30.551 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:31.554 default N sunfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
5:32.732 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
5:33.909 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:35.369 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:36.343 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
5:37.318 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
5:38.463 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
5:39.921 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

lucid dreams : 38009 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38009.1 38009.1 27.8 / 0.073% 4832.9 / 12.7% 3939.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.6 9.5 Astral Power 0.00% 59.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 38009
Heed My Call 298 (425) 0.8% (1.1%) 8.2 32.75sec 15500 0 Direct 8.2 9199 18409 10847 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 89300.09 89300.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.76 82.10% 9198.67 8901 10180 9197.96 8901 10180 62171 62171 0.00
crit 1.47 17.90% 18408.51 17802 20359 14364.64 0 20359 27129 27129 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.2 32.75sec 4653 0 Direct 8.2 3943 7886 4653 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 38304.89 38304.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.75 81.99% 3942.71 3815 4363 3940.83 0 4363 26611 26611 0.00
crit 1.48 18.01% 7885.52 7629 8725 6089.32 0 8725 11694 11694 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5029 13.3% 76.3 3.83sec 19760 15024 Direct 76.3 16747 33490 19760 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.33 0.00 0.00 1.3152 0.0000 1508393.09 1508393.09 0.00 15024.13 15024.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.60 82.00% 16746.60 9670 22097 16753.88 16112 17638 1048255 1048255 0.00
crit 13.74 18.00% 33490.09 20430 44195 33505.41 30250 38079 460138 460138 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2494 6.6% 14.2 21.25sec 52693 51663 Direct 14.2 2860 5715 3374 18.0%  
Periodic 222.5 2667 5329 3144 17.9% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 222.55 222.55 1.0200 1.3378 747515.53 747515.53 0.00 2394.36 51663.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.63 82.01% 2860.31 2589 3706 2861.58 2621 3149 33278 33278 0.00
crit 2.55 17.99% 5714.59 5177 7413 5339.49 0 7413 14582 14582 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.7 82.09% 2667.10 4 3451 2668.37 2588 2801 487232 487232 0.00
crit 39.9 17.91% 5328.59 6 6901 5331.11 4956 5740 212423 212423 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 808 2.1% 44.4 6.61sec 5456 0 Direct 44.4 4627 9251 5456 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.36 44.36 0.00 0.00 0.0000 0.0000 242026.07 242026.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.41 82.08% 4626.95 4180 5985 4628.88 4266 4996 168477 168477 0.00
crit 7.95 17.92% 9250.70 8360 11970 9250.37 0 11607 73549 73549 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2590 (4382) 6.8% (11.5%) 84.2 3.48sec 15599 17569 Direct 84.9 7757 15512 9146 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.19 84.86 0.00 0.00 0.8879 0.0000 776078.54 776078.54 0.00 17569.48 17569.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.67 82.10% 7757.35 6967 9975 7761.74 7491 8209 540432 540432 0.00
crit 15.19 17.90% 15512.37 13933 19950 15520.55 13995 17545 235646 235646 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1792 4.7% 80.2 3.64sec 6696 0 Direct 80.2 6696 0 6696 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.24 80.24 0.00 0.00 0.0000 0.0000 537240.27 537240.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.24 100.00% 6695.54 5086 14563 6699.25 5820 7850 537240 537240 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 14140 37.2% 72.2 4.21sec 58644 56554 Direct 71.9 49991 99859 58895 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.22 71.92 0.00 0.00 1.0370 0.0000 4235387.00 4235387.00 0.00 56554.02 56554.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.08 82.15% 49990.96 45067 64060 50010.66 48066 52461 2953251 2953251 0.00
crit 12.84 17.85% 99859.17 90135 128121 99878.83 90135 114926 1282136 1282136 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1623 4.3% 12.8 23.58sec 38034 36900 Direct 12.8 2446 4893 2882 17.8%  
Periodic 220.3 1729 3455 2040 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 220.32 220.32 1.0308 1.3399 486342.35 486342.35 0.00 1577.08 36900.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.51 82.20% 2446.13 2231 3195 2447.33 2278 2739 25712 25712 0.00
crit 2.28 17.80% 4893.00 4463 6390 4499.22 0 6390 11136 11136 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.6 81.97% 1728.82 7 2237 1729.66 1676 1812 312207 312207 0.00
crit 39.7 18.03% 3455.15 18 4473 3456.76 3244 3787 137288 137288 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6340 16.6% 96.8 2.91sec 19532 0 Direct 96.8 16563 33125 19532 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.81 96.81 0.00 0.00 0.0000 0.0000 1890874.81 1890874.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.46 82.08% 16562.80 15985 18282 16562.34 16014 17517 1316045 1316045 0.00
crit 17.35 17.92% 33124.79 31970 36563 33125.09 31970 35534 574830 574830 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2768 7.3% 17.5 17.14sec 47540 46596 Direct 17.5 3970 7943 4677 17.8%  
Periodic 221.7 2863 5723 3374 17.9% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.45 17.45 221.69 221.69 1.0203 1.3388 829598.41 829598.41 0.00 2636.90 46596.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.35 82.21% 3970.03 3570 5112 3971.41 3683 4369 56956 56956 0.00
crit 3.10 17.79% 7943.34 7141 10224 7659.26 0 10224 24657 24657 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.0 82.12% 2862.58 3 3706 2863.97 2771 2997 521133 521133 0.00
crit 39.6 17.88% 5722.59 18 7413 5724.83 5321 6206 226853 226853 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.01sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.03sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8639 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.00sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0151 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.4 63.5 37.7sec 4.2sec 92.31% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.87%
  • arcanic_pulsar_2:12.22%
  • arcanic_pulsar_3:11.86%
  • arcanic_pulsar_4:11.23%
  • arcanic_pulsar_5:11.07%
  • arcanic_pulsar_6:11.53%
  • arcanic_pulsar_7:11.66%
  • arcanic_pulsar_8:11.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.8sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.9sec 181.9sec 8.11% 8.21% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 28.30% 35.66% 0.0(0.0) 8.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.10% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.87%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.3 2.5 34.8sec 26.1sec 25.17% 0.00% 2.5(2.5) 8.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:353.31

Stack Uptimes

  • lucid_dreams_1:25.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.2 73.1 18.2sec 3.4sec 93.76% 99.99% 10.8(10.8) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:19.86%
  • lunar_empowerment_2:43.03%
  • lunar_empowerment_3:30.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.0sec 123.0sec 14.22% 16.54% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.5sec 33.8sec 47.74% 0.00% 3.5(48.4) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 9.0 78.5 28.6sec 3.5sec 96.61% 94.58% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.09%
  • solar_empowerment_2:47.32%
  • solar_empowerment_3:36.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.8 56.5 19.6sec 4.2sec 98.36% 93.12% 25.2(25.2) 7.5

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.46%
  • starlord_2:21.69%
  • starlord_3:61.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.64%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.2 2888.9 40.0 40.0 1466.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 85.19 790.52 (27.68%) 9.28 0.45 0.06%
celestial_alignment Astral Power 2.00 118.18 (4.14%) 59.09 1.82 1.52%
sunfire Astral Power 17.45 59.04 (2.07%) 3.38 0.00 0.00%
shooting_stars Astral Power 44.36 207.27 (7.26%) 4.67 0.25 0.12%
moonfire Astral Power 14.19 47.38 (1.66%) 3.34 0.00 0.00%
stellar_flare Astral Power 12.79 113.36 (3.97%) 8.86 0.05 0.04%
lunar_strike Astral Power 76.33 1012.72 (35.47%) 13.27 6.68 0.66%
lucid_dreams Astral Power 10.83 216.59 (7.59%) 20.00 0.00 0.00%
natures_balance Astral Power 400.63 200.15 (7.01%) 0.50 0.16 0.08%
arcanic_pulsar Astral Power 7.52 90.26 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 9.52 9.63
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.03 0.00 93.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data lucid dreams Damage Per Second
Count 7806
Mean 38009.06
Minimum 34125.27
Maximum 43106.68
Spread ( max - min ) 8981.41
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 1252.4179
5th Percentile 36029.21
95th Percentile 40135.85
( 95th Percentile - 5th Percentile ) 4106.64
Mean Distribution
Standard Deviation 14.1754
95.00% Confidence Intervall ( 37981.28 - 38036.85 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4171
0.1 Scale Factor Error with Delta=300 13391
0.05 Scale Factor Error with Delta=300 53561
0.01 Scale Factor Error with Delta=300 1339005
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 7806
Mean 38009.06
Minimum 34125.27
Maximum 43106.68
Spread ( max - min ) 8981.41
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 1252.4179
5th Percentile 36029.21
95th Percentile 40135.85
( 95th Percentile - 5th Percentile ) 4106.64
Mean Distribution
Standard Deviation 14.1754
95.00% Confidence Intervall ( 37981.28 - 38036.85 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4171
0.1 Scale Factor Error with Delta=300 13391
0.05 Scale Factor Error with Delta=300 53561
0.01 Scale Factor Error with Delta=300 1339005
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 7806
Mean 38009.06
Minimum 34125.27
Maximum 43106.68
Spread ( max - min ) 8981.41
Range [ ( max - min ) / 2 * 100% ] 11.81%
Damage
Sample Data lucid dreams Damage
Count 7806
Mean 11381061.05
Minimum 8736105.54
Maximum 14126793.62
Spread ( max - min ) 5390688.08
Range [ ( max - min ) / 2 * 100% ] 23.68%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.33 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.22 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.12 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.48 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 13.98 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.70 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.52 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 84.43 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.34 sunfire

Sample Sequence

0123456789ACDKKONPHIFGKKRQKRQKRQKRNKRORJKRQKPRQKRQKRQKRLQRKQRQJKRQKORQRKPRNQQRKRQKRKMQRQQKNPRQKRRJKQQKROQKNRQKRQPQKRKRQKLROQQKRQRQRRKKPQKNRQGROHQKRQJKRRKRQKRKPLQQKRQOQJKRKRQKNRQQKRPQQROKQNRKRKRQRQKRQRIEFPJKRKNORQRKRQKRQKRQRQLQKKRPRKRMQKQQKRNQRQRKRKROPQKRQQKNGRQHQRKKRQKRQKMKNPRQKRQRQJKRQQKRQNORKRQPKRQQKRQRKRLQKOQQKRQPJKRQRKNRQKRQKORQQRRKKRQKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.247 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lucid_dreams, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:03.089 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:03.996 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:04.903 default H memory_of_lucid_dreams Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:05.811 default I celestial_alignment Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.601 default F berserking Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.601 default G use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.601 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.357 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.111 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.867 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.719 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.473 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.227 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.048 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.802 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.557 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.310 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.064 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.820 default N sunfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.573 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.327 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.080 default O moonfire Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.835 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.589 default J cancel_buff Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.589 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.344 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.099 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.937 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.691 default P stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.444 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.196 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.992 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.745 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.500 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(5)
0:27.278 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:28.033 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:28.787 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10)
0:29.729 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
0:30.483 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(8)
0:31.238 default L sunfire Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7)
0:31.993 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7)
0:33.089 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
0:33.844 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5)
0:34.709 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4)
0:35.816 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3)
0:36.573 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
0:37.688 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
0:37.688 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), torrent_of_elements, overwhelming_power
0:38.645 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements
0:39.435 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
0:40.623 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
0:41.556 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:42.735 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:43.737 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:45.237 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:46.240 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:47.418 default P stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:48.562 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:49.535 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:50.679 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:52.140 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:53.600 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:54.575 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:55.719 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:56.568 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
0:57.838 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, conch_of_dark_whispers
0:58.925 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
0:59.823 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:00.877 default M moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:01.902 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:03.403 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:04.403 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
1:05.903 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:07.404 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:08.582 default N sunfire Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:09.729 default P stellar_flare Fluffy_Pillow 63.5/100: 64% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:10.874 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:11.847 default Q lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:13.307 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:14.453 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:15.426 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:16.400 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3)
1:16.400 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment
1:17.647 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord
1:19.193 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord
1:20.738 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:21.950 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:22.951 default O moonfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:24.127 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:25.627 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:26.806 default N sunfire Fluffy_Pillow 58.0/100: 58% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:27.951 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:28.924 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:30.382 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:31.527 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:32.501 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:33.961 default P stellar_flare Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:35.108 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:36.567 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), solar_empowerment(2), conch_of_dark_whispers
1:37.816 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord
1:38.713 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:39.767 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:40.639 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:41.945 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:42.970 default L sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:43.967 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:44.941 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:46.086 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:47.546 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:49.007 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:50.152 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:51.125 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:52.584 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:53.557 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:55.015 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:55.989 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
1:56.961 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(3), torrent_of_elements, conch_of_dark_whispers
1:58.210 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
1:59.423 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:00.601 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:02.102 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:03.282 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:04.428 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:05.402 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:06.860 default G use_items Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:06.860 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
2:07.794 default O moonfire Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:08.894 default H memory_of_lucid_dreams Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:09.994 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:11.394 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.450 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.348 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.692 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.692 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.844 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.689 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.536 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.533 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.288 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.333 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.158 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power memory_of_lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.913 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power memory_of_lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.717 default P stellar_flare Fluffy_Pillow 45.5/100: 46% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.523 default L sunfire Fluffy_Pillow 62.0/100: 62% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.304 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.454 default Q lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.603 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
2:27.510 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers
2:28.439 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
2:29.836 default O moonfire Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
2:30.935 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
2:32.342 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), overwhelming_power(8)
2:32.342 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(3), solar_empowerment(3), overwhelming_power(8)
2:33.553 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(7)
2:34.557 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(6)
2:35.745 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(5)
2:36.729 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
2:38.208 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2)
2:39.377 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power
2:40.518 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:41.493 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3)
2:42.952 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:44.411 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:45.556 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:46.527 default P stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:47.673 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:49.133 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:50.593 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:51.566 default O moonfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:52.712 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), solar_empowerment
2:53.961 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
2:55.505 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord, torrent_of_elements
2:56.717 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord, torrent_of_elements
2:57.748 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements
2:58.961 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24)
2:59.761 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
3:00.706 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22)
3:01.488 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
3:02.664 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
3:03.450 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
3:04.634 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
3:05.705 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17)
3:06.621 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
3:07.996 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(25)
3:08.887 default I celestial_alignment Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(24)
3:09.802 default E potion Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(23)
3:09.802 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:09.802 default P stellar_flare Fluffy_Pillow 83.0/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:10.637 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:10.637 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), overwhelming_power(22), battle_potion_of_intellect
3:11.549 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(21), battle_potion_of_intellect
3:12.305 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20), battle_potion_of_intellect
3:13.196 default N sunfire Fluffy_Pillow 45.0/100: 45% astral_power berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:14.064 default O moonfire Fluffy_Pillow 48.5/100: 49% astral_power berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:14.937 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:15.692 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), battle_potion_of_intellect
3:16.805 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), battle_potion_of_intellect
3:17.559 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power berserking, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(15), battle_potion_of_intellect
3:18.441 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:19.194 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:20.294 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power berserking, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:21.160 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power berserking, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:21.916 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:23.134 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:24.098 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:24.920 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:26.153 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:26.982 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:28.223 default L sunfire Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), battle_potion_of_intellect
3:29.205 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), battle_potion_of_intellect
3:30.649 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), solar_empowerment, torrent_of_elements, overwhelming_power(2), battle_potion_of_intellect
3:31.890 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power, battle_potion_of_intellect
3:33.097 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:33.967 default P stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:34.993 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:35.864 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
3:36.889 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:37.736 default M moonfire Fluffy_Pillow 42.5/100: 43% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
3:38.732 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
3:40.192 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
3:41.337 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:42.797 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:44.258 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
3:45.404 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:46.377 default N sunfire Fluffy_Pillow 39.0/100: 39% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:47.522 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:48.981 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
3:49.954 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:51.414 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power lucid_dreams, arcanic_pulsar(3), solar_empowerment(3), conch_of_dark_whispers
3:52.474 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(3), solar_empowerment(2), conch_of_dark_whispers
3:53.723 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers
3:54.753 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
3:55.967 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
3:56.969 default O moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:58.146 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:59.321 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:00.822 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
4:01.898 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
4:02.790 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
4:04.132 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
4:05.485 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
4:06.551 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19)
4:07.620 default G use_items Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
4:07.620 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), ignition_mages_fuse
4:08.497 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse
4:09.817 default H memory_of_lucid_dreams Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse
4:10.857 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse
4:12.185 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.044 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), solar_empowerment, overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.150 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.226 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:16.003 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.128 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.014 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.768 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.869 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.708 default M moonfire Fluffy_Pillow 75.0/100: 75% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.548 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.514 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.485 default P stellar_flare Fluffy_Pillow 49.0/100: 49% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(2), ignition_mages_fuse(4)
4:24.459 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power, ignition_mages_fuse(5)
4:25.261 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:26.464 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:27.408 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:28.212 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3)
4:29.671 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25)
4:30.563 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24)
4:31.902 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23)
4:31.902 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), overwhelming_power(23)
4:33.049 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(21)
4:34.004 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(20)
4:35.440 default Q lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(19)
4:36.880 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18)
4:38.015 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(16)
4:38.958 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16)
4:40.374 default N sunfire Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14)
4:41.492 default O moonfire Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13)
4:42.616 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(12)
4:43.574 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
4:44.704 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(10)
4:45.644 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9)
4:47.058 default P stellar_flare Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
4:48.175 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
4:49.296 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(5)
4:50.254 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(4)
4:51.690 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3)
4:53.134 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), overwhelming_power
4:54.376 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord
4:55.272 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord
4:56.613 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord
4:57.508 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
4:58.564 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2)
4:59.437 default L sunfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
5:00.460 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
5:01.962 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
5:03.142 default O moonfire Fluffy_Pillow 64.5/100: 65% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:04.287 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:05.746 default Q lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:07.206 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:08.350 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:09.322 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:10.784 default P stellar_flare Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:11.930 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:11.930 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), torrent_of_elements, conch_of_dark_whispers
5:13.181 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, conch_of_dark_whispers
5:14.211 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
5:15.754 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
5:16.785 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
5:17.997 default N sunfire Fluffy_Pillow 65.0/100: 65% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
5:19.174 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
5:20.175 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
5:21.677 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
5:22.855 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:23.829 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
5:25.163 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
5:26.218 default O moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers
5:27.276 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
5:28.176 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
5:29.532 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
5:30.894 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
5:31.809 default R solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
5:32.723 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(7), overwhelming_power(16), conch_of_dark_whispers
5:33.901 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers
5:35.048 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers
5:35.879 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(13), conch_of_dark_whispers
5:37.122 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(11), conch_of_dark_whispers
5:38.106 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
5:38.922 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

purification protocol : 36024 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36024.3 36024.3 24.9 / 0.069% 4349.7 / 12.1% 4457.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 36024
Heed My Call 292 (417) 0.8% (1.2%) 8.2 33.41sec 15345 0 Direct 8.2 9108 18219 10747 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 87613.07 87613.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 82.01% 9107.50 8901 9791 9107.70 0 9791 60892 60892 0.00
crit 1.47 17.99% 18218.67 17802 19582 14061.81 0 19582 26721 26721 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.2 33.41sec 4598 0 Direct 8.2 3904 7805 4598 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 37484.59 37484.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.20% 3903.50 3815 4196 3903.84 3815 4196 26161 26161 0.00
crit 1.45 17.80% 7805.34 7629 8392 6022.13 0 8392 11324 11324 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4975 13.8% 76.2 3.84sec 19584 14957 Direct 76.2 16594 33182 19584 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.16 76.16 0.00 0.00 1.3093 0.0000 1491517.85 1491517.85 0.00 14957.21 14957.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.43 81.98% 16594.28 8882 21253 16601.37 16008 17546 1036042 1036042 0.00
crit 13.73 18.02% 33181.81 17765 42507 33195.12 30174 38023 455476 455476 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2443 6.8% 14.1 21.32sec 51965 50843 Direct 14.1 2855 5705 3361 17.7%  
Periodic 220.9 2628 5253 3100 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 220.86 220.86 1.0221 1.3444 731991.25 731991.25 0.00 2351.29 50843.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.59 82.26% 2855.45 2589 3565 2857.34 2632 3196 33089 33089 0.00
crit 2.50 17.74% 5704.77 5177 7129 5332.44 0 7129 14252 14252 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.2 82.02% 2628.06 3 3319 2629.28 2558 2751 476085 476085 0.00
crit 39.7 17.98% 5252.87 3 6638 5255.18 4881 5703 208566 208566 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 605 1.7% 16.5 17.45sec 10968 0 Direct 16.5 9295 18592 10969 18.0%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.54 0.00 0.00 0.0000 0.0000 181432.76 181432.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.56 82.00% 9295.09 9083 9991 9294.64 9083 9862 126081 126081 0.00
crit 2.98 18.00% 18592.36 18166 19983 17626.82 0 19983 55351 55351 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8271.92
  • base_dd_max:8271.92
  • base_dd_mult:1.00
 
Purifying Blast 0 (677) 0.0% (1.9%) 5.5 60.37sec 36983 32246

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1471 0.0000 0.00 0.00 0.00 32245.73 32245.73
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purifying Blast (purifying_tick) 677 1.9% 38.0 7.63sec 5331 0 Periodic 38.0 4533 9069 5331 17.6% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.98 0.00 0.00 37.98 0.0000 0.0000 202438.67 202438.67 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.3 82.42% 4533.22 4441 4885 4533.05 4441 4789 141894 141894 0.00
crit 6.7 17.58% 9069.05 8881 9769 9062.79 0 9769 60544 60544 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295338
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295338
  • name:Purifying Blast
  • school:fire
  • tooltip:
  • description:{$@spelldesc295337=Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4043.71
  • base_dd_max:4043.71
  • base_dd_mult:1.00
 
Shooting Stars 793 2.2% 44.2 6.62sec 5378 0 Direct 44.2 4560 9109 5378 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.16 44.16 0.00 0.00 0.0000 0.0000 237496.02 237496.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.22 82.02% 4559.80 4180 5756 4561.76 4291 5036 165154 165154 0.00
crit 7.94 17.98% 9108.87 8360 11513 9102.65 0 10989 72343 72343 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2764 (4380) 7.7% (12.2%) 91.4 3.22sec 14372 15950 Direct 91.9 7643 15273 9016 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.36 91.89 0.00 0.00 0.9011 0.0000 828493.71 828493.71 0.00 15949.99 15949.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.35 82.00% 7642.66 6967 9594 7647.17 7381 8030 575899 575899 0.00
crit 16.54 18.00% 15273.45 13933 19188 15280.86 13933 17441 252595 252595 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1616 4.5% 73.4 3.98sec 6600 0 Direct 73.4 6600 0 6600 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.41 73.41 0.00 0.00 0.0000 0.0000 484525.58 484525.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.41 100.00% 6599.93 5086 14007 6602.97 5675 7808 484526 484526 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11691 32.5% 60.5 4.99sec 57900 55086 Direct 60.3 49257 98412 58078 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.49 60.31 0.00 0.00 1.0511 0.0000 3502672.96 3502672.96 0.00 55086.47 55086.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.49 82.06% 49256.59 45067 61614 49281.06 47540 51886 2437607 2437607 0.00
crit 10.82 17.94% 98412.09 90135 123227 98458.63 90135 114767 1065066 1065066 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1584 4.4% 12.8 23.58sec 37239 35846 Direct 12.8 2397 4788 2828 18.0%  
Periodic 218.5 1703 3404 2008 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 218.52 218.52 1.0389 1.3470 474820.94 474820.94 0.00 1543.61 35846.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 81.99% 2397.20 2231 3073 2398.21 2231 2619 25063 25063 0.00
crit 2.30 18.01% 4788.43 4463 6146 4403.34 0 6146 10994 10994 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.4 82.09% 1703.18 10 2151 1704.01 1655 1780 305515 305515 0.00
crit 39.1 17.91% 3404.18 51 4302 3405.57 3180 3731 133250 133250 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5740 15.9% 88.7 3.13sec 19280 0 Direct 88.7 16352 32703 19280 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.73 88.73 0.00 0.00 0.0000 0.0000 1710741.17 1710741.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.85 82.10% 16351.95 15985 17583 16351.51 15985 17499 1191180 1191180 0.00
crit 15.89 17.90% 32702.76 31970 35167 32705.33 31970 34938 519561 519561 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2719 7.6% 17.9 16.63sec 45409 44213 Direct 17.9 3913 7825 4621 18.1%  
Periodic 220.0 2823 5640 3327 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 220.01 220.01 1.0271 1.3454 814980.49 814980.49 0.00 2591.84 44213.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.70 81.91% 3912.95 3570 4917 3913.84 3666 4251 57525 57525 0.00
crit 3.25 18.09% 7824.94 7141 9834 7603.74 0 9834 25402 25402 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.6 82.09% 2822.79 2 3565 2824.18 2745 2948 509803 509803 0.00
crit 39.4 17.91% 5639.87 21 7129 5642.14 5249 6142 222250 222250 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.19sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9048 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.2 44.7sec 5.0sec 92.83% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.33%
  • arcanic_pulsar_2:10.26%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:10.66%
  • arcanic_pulsar_5:13.76%
  • arcanic_pulsar_6:10.38%
  • arcanic_pulsar_7:10.83%
  • arcanic_pulsar_8:14.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.11% 7.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.74% 32.49% 0.0(0.0) 8.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.4sec 45.6sec 23.54% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.5 45.5 9.0sec 3.8sec 81.99% 99.69% 1.9(1.9) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.19%
  • lunar_empowerment_2:31.71%
  • lunar_empowerment_3:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.6sec 34.0sec 47.50% 0.00% 3.4(47.9) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.90%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.3 51.5 12.2sec 4.0sec 85.81% 80.02% 0.3(0.3) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.94%
  • solar_empowerment_2:39.74%
  • solar_empowerment_3:18.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.05% 92.06% 15.4(15.4) 11.4

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.87%
  • starlord_2:22.48%
  • starlord_3:59.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.8sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.5 2419.8 40.0 40.0 1447.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.36 738.85 (31.02%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.95 53.84 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.16 176.62 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.09 42.26 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.01 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.16 913.86 (38.36%) 12.00 0.04 0.00%
natures_balance Astral Power 400.63 200.31 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.41 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.84 0.00 94.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data purification protocol Damage Per Second
Count 7806
Mean 36024.34
Minimum 32616.93
Maximum 40027.14
Spread ( max - min ) 7410.22
Range [ ( max - min ) / 2 * 100% ] 10.29%
Standard Deviation 1122.6643
5th Percentile 34247.46
95th Percentile 37920.10
( 95th Percentile - 5th Percentile ) 3672.64
Mean Distribution
Standard Deviation 12.7068
95.00% Confidence Intervall ( 35999.44 - 36049.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3731
0.1 Scale Factor Error with Delta=300 10760
0.05 Scale Factor Error with Delta=300 43038
0.01 Scale Factor Error with Delta=300 1075929
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 7806
Mean 36024.34
Minimum 32616.93
Maximum 40027.14
Spread ( max - min ) 7410.22
Range [ ( max - min ) / 2 * 100% ] 10.29%
Standard Deviation 1122.6643
5th Percentile 34247.46
95th Percentile 37920.10
( 95th Percentile - 5th Percentile ) 3672.64
Mean Distribution
Standard Deviation 12.7068
95.00% Confidence Intervall ( 35999.44 - 36049.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3731
0.1 Scale Factor Error with Delta=300 10760
0.05 Scale Factor Error with Delta=300 43038
0.01 Scale Factor Error with Delta=300 1075929
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 7806
Mean 36024.34
Minimum 32616.93
Maximum 40027.14
Spread ( max - min ) 7410.22
Range [ ( max - min ) / 2 * 100% ] 10.29%
Damage
Sample Data purification protocol Damage
Count 7806
Mean 10786209.06
Minimum 8407359.01
Maximum 13092303.33
Spread ( max - min ) 4684944.32
Range [ ( max - min ) / 2 * 100% ] 21.72%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.47 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.78 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.49 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.05 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.77 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.54 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.32 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.53 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.63 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRKRQNRQORQRSKPKRLQKQQRRRRRKRKRQRQRJKOQKNPQQKRQRKRQQRHKNOQKRQPRKRQRRRRNRRKRKRQKMQQKPRQKNRQQKROQKRQQQNRKPRHQRKQGKRQKRQRMKNQRQRQRQRJKKPQQKONRQKRQQRQRRKKPQNQKORQRKLRHQRQKQIEFKPRKRQKORNRQKRQRQRQKLKQQRPKRKRQRMQQRNKKQRQQKRQOPHRQNRGJKRQRKRQKRQKROQNPQRRKRKRKRLQQKQQRKOQQPKRQNRRKQRRKQHROQRKQNPKRQKRQMRQRRRRQKKNQQKRQRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.211 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.144 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.078 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.011 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.824 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.824 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.824 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:06.577 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.331 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.086 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.841 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.694 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.449 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.203 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.959 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.778 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.534 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.288 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.042 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.830 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.584 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.338 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.127 default O moonfire Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.882 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.636 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.472 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.227 default S sunfire Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.981 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.735 default P stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.490 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
0:24.243 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:24.998 default L sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.751 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:26.704 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2)
0:27.611 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:28.735 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:29.860 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3)
0:30.615 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:31.369 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:32.122 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.005 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.887 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.772 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:35.526 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3)
0:36.294 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:37.047 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:38.024 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:38.778 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:39.754 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:40.520 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:40.520 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2)
0:41.355 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:42.569 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
0:44.112 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:45.325 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:46.502 default P stellar_flare Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:47.678 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:49.180 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:50.681 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:51.858 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:52.832 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
0:54.164 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
0:55.058 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
0:56.116 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21)
0:57.016 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:58.374 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
0:59.712 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(23)
1:00.606 default H purifying_blast Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(22)
1:01.759 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(21)
1:02.916 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20)
1:04.043 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18)
1:05.180 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(17)
1:06.629 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(16)
1:07.774 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15)
1:08.721 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
1:10.147 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(24)
1:11.228 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(23)
1:12.150 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(22)
1:13.238 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
1:14.141 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
1:15.498 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:16.407 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18)
1:17.319 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17)
1:18.395 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16)
1:19.476 default N sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15)
1:20.562 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14)
1:21.650 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13)
1:22.741 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(12)
1:23.937 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11)
1:24.797 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(10)
1:25.814 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9)
1:26.658 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(8)
1:27.925 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(7)
1:28.925 default M moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6)
1:29.899 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5)
1:31.333 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3)
1:32.775 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
1:33.915 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power
1:35.056 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:36.029 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:37.488 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:38.633 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:39.780 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:40.752 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:42.213 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
1:43.669 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), solar_empowerment(2)
1:44.916 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
1:45.947 default O moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:47.159 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:48.704 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
1:49.917 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
1:50.919 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
1:52.417 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:53.919 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:55.421 default N sunfire Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), torrent_of_elements
1:56.601 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
1:57.517 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
1:58.598 default P stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
1:59.653 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
2:00.552 default H purifying_blast Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:01.668 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
2:03.026 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
2:03.921 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), solar_empowerment, torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
2:05.064 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
2:06.490 default G use_items Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:06.490 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse
2:07.571 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse
2:08.351 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:09.522 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse
2:10.424 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse
2:11.181 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.263 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(2)
2:13.017 default M moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(2)
2:13.875 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(2)
2:14.858 default N sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(3)
2:15.798 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
2:16.996 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
2:17.800 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
2:19.003 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
2:19.787 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
2:20.959 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
2:21.744 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
2:22.922 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(17), ignition_mages_fuse(5)
2:23.685 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
2:23.685 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(2), overwhelming_power(16), ignition_mages_fuse(5)
2:24.666 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), ignition_mages_fuse(5)
2:25.623 default P stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), ignition_mages_fuse(5)
2:26.554 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers
2:27.984 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers
2:29.419 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers
2:30.556 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), conch_of_dark_whispers
2:31.665 default N sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8), conch_of_dark_whispers
2:32.779 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers
2:33.728 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:35.154 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:36.283 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:37.247 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:38.697 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
2:40.151 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:41.125 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:42.586 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:43.560 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:44.533 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(6), torrent_of_elements, conch_of_dark_whispers
2:45.782 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
2:46.995 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:48.171 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:49.672 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:50.850 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:52.351 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
2:53.529 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:54.527 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:55.374 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:56.644 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, solar_empowerment(3), starlord(3), torrent_of_elements
2:57.491 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements
2:58.489 default L sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:59.486 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:00.458 default H purifying_blast Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:01.751 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:03.210 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:04.104 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
3:05.446 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, overwhelming_power(22)
3:06.598 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(21)
3:08.030 default I celestial_alignment Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(19)
3:09.013 default E potion Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(18)
3:09.013 default F berserking Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(18), battle_potion_of_intellect
3:09.013 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(18), battle_potion_of_intellect
3:09.911 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:10.784 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(17), battle_potion_of_intellect
3:11.539 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16), battle_potion_of_intellect
3:12.417 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:13.171 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:14.268 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:15.133 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:16.001 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:16.756 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:17.626 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:18.380 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:19.496 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:20.374 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:21.128 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:22.371 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:23.203 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:24.453 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:25.438 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(2), battle_potion_of_intellect
3:26.918 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(6), celestial_alignment, overwhelming_power, battle_potion_of_intellect
3:27.998 default L sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:29.053 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:30.266 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:31.766 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:33.265 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:34.267 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
3:35.444 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
3:36.620 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:37.467 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
3:38.466 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:39.313 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
3:40.581 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:41.429 default M moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
3:42.424 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
3:43.883 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
3:45.342 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
3:46.315 default N sunfire Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar, lunar_empowerment, starlord(3)
3:47.461 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, lunar_empowerment
3:48.710 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
3:49.923 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
3:51.422 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:52.424 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:53.924 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
3:55.425 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
3:56.602 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
3:57.575 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:59.035 default O moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:00.181 default P stellar_flare Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:01.325 default H purifying_blast Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:02.473 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:03.446 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:04.905 default N sunfire Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:06.049 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:07.024 default G use_items Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:07.024 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
4:07.024 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), ignition_mages_fuse
4:08.222 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord, ignition_mages_fuse
4:09.210 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse
4:10.692 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, ignition_mages_fuse
4:11.681 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(2)
4:12.799 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(2)
4:13.724 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(2)
4:15.108 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(3)
4:16.152 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:17.015 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:18.308 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:19.327 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:20.161 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:21.141 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:22.389 default N sunfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:23.369 default P stellar_flare Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(5)
4:24.315 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:25.520 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:26.323 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:27.125 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8)
4:28.374 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
4:29.270 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord
4:30.324 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
4:31.194 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
4:32.217 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
4:33.065 default L sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
4:34.062 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements
4:35.521 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements
4:36.982 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
4:38.030 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
4:39.372 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
4:40.721 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
4:41.623 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
4:42.688 default O moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
4:43.759 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
4:45.125 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
4:46.501 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
4:47.586 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), torrent_of_elements, overwhelming_power(14)
4:48.773 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(13)
4:49.757 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(12)
4:51.237 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(10), conch_of_dark_whispers
4:52.405 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(9), conch_of_dark_whispers
4:53.401 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(8), conch_of_dark_whispers
4:54.401 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), starlord, overwhelming_power(7), conch_of_dark_whispers
4:55.581 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(6), conch_of_dark_whispers
4:57.049 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(4), conch_of_dark_whispers
4:58.036 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(3), conch_of_dark_whispers
4:59.202 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(2), conch_of_dark_whispers
5:00.371 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power, conch_of_dark_whispers
5:01.822 default H purifying_blast Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
5:02.970 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
5:03.943 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), conch_of_dark_whispers
5:05.088 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), conch_of_dark_whispers
5:06.549 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord(3)
5:07.695 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7)
5:08.942 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
5:10.485 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord
5:11.698 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord
5:12.909 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord
5:14.120 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:14.992 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
5:16.295 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:17.318 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:18.168 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:19.436 default M moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:20.433 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:21.408 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:22.867 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), conch_of_dark_whispers
5:23.838 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:24.812 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers
5:25.786 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar, starlord(3), conch_of_dark_whispers
5:26.931 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), conch_of_dark_whispers
5:28.390 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar, conch_of_dark_whispers
5:29.639 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
5:30.854 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:32.032 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:33.534 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
5:35.036 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
5:36.214 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
5:37.188 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
5:38.649 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
5:39.622 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

ripple in space : 36214 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36213.6 36213.6 25.3 / 0.070% 4372.2 / 12.1% 4481.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 36214
Heed My Call 292 (417) 0.8% (1.2%) 8.1 33.69sec 15369 0 Direct 8.1 9110 18226 10748 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.0000 0.0000 87479.66 87479.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 82.04% 9110.18 8901 9791 9105.29 0 9791 60831 60831 0.00
crit 1.46 17.96% 18226.18 17802 19582 14129.82 0 19582 26648 26648 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.1 33.69sec 4621 0 Direct 8.1 3904 7810 4622 18.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.0000 0.0000 37615.65 37615.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.65 81.64% 3904.46 3815 4196 3904.68 3815 4196 25946 25946 0.00
crit 1.49 18.36% 7810.26 7629 8392 6122.54 0 8392 11669 11669 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5174 14.3% 76.1 3.84sec 20395 15580 Direct 76.1 17279 34535 20395 18.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.06 76.06 0.00 0.00 1.3091 0.0000 1551283.37 1551283.37 0.00 15579.83 15579.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.33 81.95% 17279.15 8882 22539 17286.68 16581 18312 1077009 1077009 0.00
crit 13.73 18.05% 34535.18 17765 45078 34550.13 30574 41431 474274 474274 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2546 7.0% 14.1 21.32sec 54184 53009 Direct 14.1 2981 5963 3519 18.0%  
Periodic 220.9 2738 5472 3230 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 220.87 220.87 1.0222 1.3443 762850.86 762850.86 0.00 2450.48 53008.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 81.96% 2981.45 2589 3780 2983.59 2738 3280 34403 34403 0.00
crit 2.54 18.04% 5963.02 5177 7561 5578.79 0 7561 15145 15145 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.01% 2737.68 2 3520 2739.03 2654 2864 495875 495875 0.00
crit 39.7 17.99% 5471.63 11 7039 5473.79 5132 5924 217429 217429 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 348 1.0% 5.5 60.37sec 19014 16583 Direct 5.4 19117 0 19117 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 5.44 0.00 0.00 1.1468 0.0000 104074.23 104074.23 0.00 16582.89 16582.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 19116.90 18744 20618 19115.72 18744 20306 104074 104074 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17069.54
  • base_dd_max:17069.54
  • base_dd_mult:1.00
 
Shooting Stars 824 2.3% 44.1 6.62sec 5600 0 Direct 44.1 4749 9492 5600 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.12 44.12 0.00 0.00 0.0000 0.0000 247068.10 247068.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.20 82.06% 4749.30 4180 6104 4751.17 4438 5174 171935 171935 0.00
crit 7.92 17.94% 9491.89 8360 12209 9491.34 0 12209 75133 75133 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2882 (4562) 8.0% (12.6%) 91.5 3.22sec 14943 16577 Direct 92.0 7963 15908 9386 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.50 92.02 0.00 0.00 0.9014 0.0000 863665.35 863665.35 0.00 16576.95 16576.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.54 82.09% 7963.10 6967 10174 7968.20 7682 8432 601501 601501 0.00
crit 16.48 17.91% 15908.09 13933 20348 15917.46 14393 18070 262165 262165 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1680 4.6% 73.3 4.00sec 6870 0 Direct 73.3 6870 0 6870 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.31 73.31 0.00 0.00 0.0000 0.0000 503634.82 503634.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.31 100.00% 6869.74 5086 14854 6873.63 5932 8034 503635 503635 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 12122 33.5% 60.5 4.99sec 60040 57125 Direct 60.3 51107 102120 60233 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.49 60.29 0.00 0.00 1.0510 0.0000 3631708.11 3631708.11 0.00 57124.78 57124.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.51 82.11% 51106.82 45067 65034 51131.36 49227 53992 2530235 2530235 0.00
crit 10.79 17.89% 102120.05 90135 130068 102168.12 0 117551 1101473 1101473 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1651 4.6% 12.7 23.57sec 38811 37358 Direct 12.7 2492 4980 2936 17.8%  
Periodic 218.5 1774 3546 2093 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 218.53 218.53 1.0389 1.3470 494737.82 494737.82 0.00 1608.39 37358.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.47 82.17% 2492.17 2231 3259 2493.39 2313 2745 26102 26102 0.00
crit 2.27 17.83% 4979.54 4463 6518 4533.88 0 6518 11321 11321 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.2 82.01% 1773.92 1 2281 1774.80 1721 1858 317920 317920 0.00
crit 39.3 17.99% 3545.57 88 4562 3547.16 3306 3867 139395 139395 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5738 15.8% 88.7 3.13sec 19274 0 Direct 88.7 16356 32708 19274 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.72 88.72 0.00 0.00 0.0000 0.0000 1709938.45 1709938.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.89 82.16% 16355.92 15985 17583 16355.94 15985 17154 1192146 1192146 0.00
crit 15.83 17.84% 32707.85 31970 35167 32708.22 31970 35007 517793 517793 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2833 7.8% 18.0 16.63sec 47282 46023 Direct 18.0 4079 8155 4812 18.0%  
Periodic 220.0 2940 5875 3466 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 220.02 220.02 1.0274 1.3453 848994.29 848994.29 0.00 2699.93 46023.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.73 82.02% 4079.36 3570 5214 4080.44 3805 4465 60079 60079 0.00
crit 3.23 17.98% 8154.53 7141 10429 7883.49 0 10429 26324 26324 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.6 82.08% 2940.01 2 3780 2941.46 2853 3085 530961 530961 0.00
crit 39.4 17.92% 5875.46 16 7561 5878.21 5499 6422 231631 231631 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.44sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.08sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9048 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.2 44.7sec 5.0sec 92.82% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.31%
  • arcanic_pulsar_2:10.26%
  • arcanic_pulsar_3:11.29%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.77%
  • arcanic_pulsar_6:10.39%
  • arcanic_pulsar_7:10.84%
  • arcanic_pulsar_8:14.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.2sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 7.76% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.74% 32.48% 0.0(0.0) 8.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.60% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.8 45.2 9.0sec 3.8sec 81.81% 99.68% 1.8(1.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.41%
  • lunar_empowerment_2:31.51%
  • lunar_empowerment_3:13.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.3sec 34.0sec 47.67% 0.00% 3.4(47.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 9.8 0.0 32.2sec 32.2sec 63.00% 0.00% 188.7(188.7) 9.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:668.07

Stack Uptimes

  • reality_shift_1:63.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.5 51.2 12.1sec 4.0sec 85.69% 79.80% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.16%
  • solar_empowerment_2:39.60%
  • solar_empowerment_3:17.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.03% 92.01% 15.4(15.4) 11.5

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.85%
  • starlord_2:22.46%
  • starlord_3:59.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.6sec 23.79% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.79%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.5 2419.5 40.0 40.0 1501.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.50 739.97 (31.07%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.96 53.87 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.12 176.46 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.08 42.24 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.98 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.06 912.70 (38.32%) 12.00 0.05 0.01%
natures_balance Astral Power 400.63 200.31 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.40 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.41 0.00 67.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data ripple in space Damage Per Second
Count 7806
Mean 36213.60
Minimum 32784.52
Maximum 40913.69
Spread ( max - min ) 8129.17
Range [ ( max - min ) / 2 * 100% ] 11.22%
Standard Deviation 1140.6235
5th Percentile 34426.29
95th Percentile 38154.08
( 95th Percentile - 5th Percentile ) 3727.80
Mean Distribution
Standard Deviation 12.9101
95.00% Confidence Intervall ( 36188.30 - 36238.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3811
0.1 Scale Factor Error with Delta=300 11107
0.05 Scale Factor Error with Delta=300 44426
0.01 Scale Factor Error with Delta=300 1110628
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 7806
Mean 36213.60
Minimum 32784.52
Maximum 40913.69
Spread ( max - min ) 8129.17
Range [ ( max - min ) / 2 * 100% ] 11.22%
Standard Deviation 1140.6235
5th Percentile 34426.29
95th Percentile 38154.08
( 95th Percentile - 5th Percentile ) 3727.80
Mean Distribution
Standard Deviation 12.9101
95.00% Confidence Intervall ( 36188.30 - 36238.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3811
0.1 Scale Factor Error with Delta=300 11107
0.05 Scale Factor Error with Delta=300 44426
0.01 Scale Factor Error with Delta=300 1110628
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 7806
Mean 36213.60
Minimum 32784.52
Maximum 40913.69
Spread ( max - min ) 8129.17
Range [ ( max - min ) / 2 * 100% ] 11.22%
Damage
Sample Data ripple in space Damage
Count 7806
Mean 10843050.73
Minimum 8535165.05
Maximum 13319885.73
Spread ( max - min ) 4784720.68
Range [ ( max - min ) / 2 * 100% ] 22.06%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.47 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.76 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.49 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.04 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.56 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.30 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.43 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.76 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQRKRQNRQORQRKPKRLQKQRQQRRRQKRKRQRQRJKKNOQPKRQQRKQRQRRHKNOQKQQPRKRQRQNRRKRKRQKMQQQKPNQRQRKQKOQRQKQRNRKPQHRRKQGRRKORQRKLQQKQRRQPKQRKQONRRKQRRQRRRQKKPNQKORQQRRRHRJKRKRFKRQLPIEKRQKORQRQRJKRKNRQKRQMQKPQQRRQKNKRQKMQQRKQRQPRHNKQKGQRRRKOQRRKQRNRRRKPQRKRQKRQMRRKNQQRKQRPKQRRKQNORQRHRRKQKQQPKNRQQORRRRRKRKRKRLQQKQRQK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.209 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.143 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.076 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.010 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.825 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.825 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.825 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.578 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.333 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.209 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.964 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.719 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.573 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.329 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.085 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.904 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.657 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.413 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.168 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.956 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.711 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.464 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.218 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.973 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.728 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.506 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.260 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.016 default P stellar_flare Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.770 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.524 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), ignition_mages_fuse(5)
0:24.279 default L sunfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), ignition_mages_fuse(5)
0:25.033 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(22), ignition_mages_fuse(5)
0:25.925 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25)
0:26.754 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24)
0:27.782 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
0:28.538 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
0:29.573 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
0:30.611 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:31.366 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(19)
0:32.119 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(18)
0:32.946 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(18)
0:33.998 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17)
0:34.828 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
0:35.582 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15)
0:36.336 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:37.090 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13)
0:38.021 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12)
0:38.774 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12)
0:39.709 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(11)
0:40.463 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(10)
0:40.463 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, overwhelming_power(10)
0:41.270 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9)
0:42.442 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8)
0:43.588 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7)
0:44.736 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6)
0:46.202 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
0:47.364 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3)
0:48.528 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(2)
0:49.495 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
0:50.948 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:52.407 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
0:53.381 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements
0:54.527 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:55.987 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:56.961 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:58.422 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:59.396 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
1:00.371 default H ripple_in_space Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements
1:01.516 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(5), lunar_empowerment, conch_of_dark_whispers
1:02.764 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:03.976 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:05.188 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:06.732 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:07.944 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:09.444 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:10.944 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:12.123 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:13.125 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:14.302 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:15.275 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:16.735 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:17.709 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3)
1:19.169 default N sunfire Fluffy_Pillow 61.5/100: 62% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3)
1:20.315 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3)
1:21.288 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power reality_shift, arcanic_pulsar(8), starlord(3)
1:22.435 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power reality_shift, arcanic_pulsar(8)
1:23.683 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:24.580 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord
1:25.635 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:26.505 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
1:27.811 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
1:28.836 default M moonfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:29.832 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:31.290 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
1:32.749 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:34.209 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers
1:35.354 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:36.498 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:37.643 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:39.101 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:40.077 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:41.536 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:42.508 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power reality_shift, arcanic_pulsar(3)
1:43.756 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
1:45.301 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements
1:46.514 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:47.693 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:49.193 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements
1:50.193 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24)
1:51.568 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23)
1:52.653 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
1:54.000 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
1:54.905 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
1:55.970 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
1:56.878 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power reality_shift, arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(18)
1:57.951 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
1:59.028 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15)
2:00.409 default H ripple_in_space Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(14)
2:01.497 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(13)
2:02.424 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(12)
2:03.521 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), overwhelming_power(11)
2:04.720 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10), conch_of_dark_whispers
2:06.211 default G use_items Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(8), conch_of_dark_whispers
2:06.211 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse
2:07.173 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), starlord, overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse
2:08.308 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, arcanic_pulsar(8), starlord, overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse
2:09.446 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse
2:10.413 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.205 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.396 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.334 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.274 default L sunfire Fluffy_Pillow 8.5/100: 9% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.156 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.453 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.750 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.767 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.015 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:20.848 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3), ignition_mages_fuse(4)
2:21.680 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, starlord(3), ignition_mages_fuse(4)
2:22.927 default P stellar_flare Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(2), starlord(3), ignition_mages_fuse(5)
2:23.872 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power reality_shift, arcanic_pulsar(2), ignition_mages_fuse(5)
2:24.901 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
2:26.176 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord, ignition_mages_fuse(5)
2:27.027 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar(3), starlord
2:28.240 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2)
2:29.741 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:30.920 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:32.097 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:33.099 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), conch_of_dark_whispers
2:34.102 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), starlord(2), conch_of_dark_whispers
2:35.280 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
2:36.738 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
2:37.710 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
2:38.855 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), conch_of_dark_whispers
2:40.315 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
2:41.288 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power reality_shift, arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
2:42.434 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power reality_shift, arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
2:43.579 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, starlord(3)
2:45.039 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power reality_shift, arcanic_pulsar(5)
2:46.288 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
2:47.500 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:48.677 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:49.855 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:51.356 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
2:52.532 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:53.679 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:54.651 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:56.110 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
2:57.448 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(23)
2:58.345 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(22)
2:59.243 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(21)
3:00.307 default H ripple_in_space Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20)
3:01.473 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19)
3:02.542 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18)
3:02.542 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), overwhelming_power(18)
3:03.711 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
3:04.553 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(16)
3:05.548 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(15)
3:06.373 default F berserking Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(14)
3:06.373 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(14)
3:07.256 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13)
3:08.010 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12)
3:09.114 default L sunfire Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11)
3:09.985 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(11)
3:10.986 default I celestial_alignment Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10)
3:11.860 default E potion Fluffy_Pillow 84.5/100: 85% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9)
3:11.860 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:12.735 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:13.489 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:14.612 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:15.499 default O moonfire Fluffy_Pillow 31.0/100: 31% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:16.389 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:17.148 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:18.290 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(2), battle_potion_of_intellect
3:19.189 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power, battle_potion_of_intellect
3:20.452 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect
3:21.449 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect
3:21.449 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, battle_potion_of_intellect
3:22.535 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
3:23.431 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord, battle_potion_of_intellect
3:24.485 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:25.509 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:26.380 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(2), battle_potion_of_intellect
3:27.687 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(2), battle_potion_of_intellect
3:28.712 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:29.560 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect
3:30.830 default M moonfire Fluffy_Pillow 35.5/100: 36% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect
3:31.826 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord(3), battle_potion_of_intellect
3:33.286 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:34.432 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:35.577 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:37.037 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
3:38.496 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
3:39.468 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
3:40.441 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
3:41.899 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power reality_shift, arcanic_pulsar(8)
3:43.147 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
3:44.202 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
3:45.256 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:46.128 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
3:47.434 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
3:48.458 default M moonfire Fluffy_Pillow 9.0/100: 9% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:49.452 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:50.913 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
3:52.374 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3)
3:53.346 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3)
3:54.491 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:55.950 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:56.924 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:58.384 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
3:59.432 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
4:00.326 default H ripple_in_space Fluffy_Pillow 60.0/100: 60% astral_power reality_shift, arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(23)
4:01.463 default N sunfire Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(22)
4:02.522 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(21)
4:03.677 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
4:05.113 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18)
4:06.249 default G use_items Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17)
4:06.249 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), ignition_mages_fuse
4:07.606 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse
4:08.513 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse
4:09.423 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, overwhelming_power(14), ignition_mages_fuse
4:10.499 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), starlord(2), overwhelming_power(13), ignition_mages_fuse(2)
4:11.539 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
4:12.553 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), ignition_mages_fuse(2)
4:13.849 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(10), ignition_mages_fuse(2)
4:14.716 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(6), starlord(3), overwhelming_power(9), ignition_mages_fuse(3)
4:15.702 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, arcanic_pulsar(6), starlord(3), overwhelming_power(8), ignition_mages_fuse(3)
4:16.695 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), ignition_mages_fuse(3)
4:17.958 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(6), ignition_mages_fuse(3)
4:18.806 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(5), ignition_mages_fuse(4)
4:19.772 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
4:20.740 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(3), ignition_mages_fuse(4)
4:21.710 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(2), ignition_mages_fuse(4)
4:22.684 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power reality_shift, arcanic_pulsar(7), overwhelming_power, ignition_mages_fuse(5)
4:23.711 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
4:24.712 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
4:25.987 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord, ignition_mages_fuse(5)
4:26.836 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(8), starlord
4:28.049 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
4:28.920 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(2)
4:30.226 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, celestial_alignment, starlord(2)
4:31.251 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
4:32.099 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
4:33.368 default M moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, celestial_alignment, starlord(3), conch_of_dark_whispers
4:34.365 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord(3), conch_of_dark_whispers
4:35.510 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(3), conch_of_dark_whispers
4:36.655 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), conch_of_dark_whispers
4:37.800 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
4:38.946 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
4:40.405 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
4:41.864 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers
4:42.838 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), conch_of_dark_whispers
4:44.087 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
4:45.631 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, conch_of_dark_whispers
4:46.661 default P stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord, conch_of_dark_whispers
4:47.876 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord, conch_of_dark_whispers
4:49.088 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:50.589 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
4:51.509 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers
4:52.430 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, arcanic_pulsar(4), starlord(2), overwhelming_power(22), conch_of_dark_whispers
4:53.516 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
4:54.868 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
4:55.935 default O moonfire Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
4:57.005 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
4:57.920 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
4:59.289 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power reality_shift, arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
5:00.371 default H ripple_in_space Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(14)
5:01.498 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power reality_shift, arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(13)
5:02.589 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power reality_shift, arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(12)
5:03.685 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, torrent_of_elements, overwhelming_power(11)
5:04.884 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
5:06.373 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8)
5:07.549 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7)
5:09.012 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5)
5:10.484 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(4)
5:11.644 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(3)
5:12.807 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2)
5:13.945 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power
5:14.917 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:16.377 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
5:17.837 default O moonfire Fluffy_Pillow 43.5/100: 44% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
5:18.983 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
5:19.956 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
5:20.928 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power reality_shift, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:22.074 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power reality_shift, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:23.218 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power reality_shift, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:24.363 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power reality_shift, arcanic_pulsar(8), conch_of_dark_whispers
5:25.612 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
5:26.508 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers
5:27.561 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
5:28.431 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
5:29.455 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
5:30.302 default L sunfire Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
5:31.299 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(3), starlord(3), conch_of_dark_whispers
5:32.758 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
5:34.219 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
5:35.366 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
5:36.827 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
5:37.800 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
5:39.258 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

unbound force : 36675 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36674.7 36674.7 24.6 / 0.067% 4334.6 / 11.8% 4530.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 36675
Heed My Call 301 (430) 0.8% (1.2%) 8.1 33.82sec 15879 0 Direct 8.1 9107 18218 11116 22.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 0.00 0.00 0.0000 0.0000 90226.08 90226.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 77.95% 9107.29 8901 9791 9104.80 0 9791 57621 57621 0.00
crit 1.79 22.05% 18218.35 17802 19582 15347.73 0 19582 32605 32605 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.4% 8.1 33.82sec 4763 0 Direct 8.1 3903 7809 4763 22.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 0.00 0.00 0.0000 0.0000 38656.25 38656.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 77.99% 3902.98 3815 4196 3902.27 0 4196 24707 24707 0.00
crit 1.79 22.01% 7808.91 7629 8392 6573.27 0 8392 13949 13949 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5073 13.8% 76.2 3.84sec 19957 15227 Direct 76.2 16586 33088 19957 20.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.22 76.22 0.00 0.00 1.3106 0.0000 1521059.14 1521059.14 0.00 15226.88 15226.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.65 79.57% 16585.81 8882 21253 16593.12 15937 17433 1005934 1005934 0.00
crit 15.57 20.43% 33088.23 17765 42507 33100.98 29948 37292 515125 515125 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2515 6.9% 14.1 21.33sec 53570 52442 Direct 14.1 2856 5693 3464 21.4%  
Periodic 220.9 2630 5239 3192 21.5% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 14.07 220.92 220.92 1.0215 1.3440 753849.89 753849.89 0.00 2421.74 52441.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.06 78.57% 2855.92 2589 3565 2857.62 2627 3145 31577 31577 0.00
crit 3.02 21.43% 5692.57 5177 7129 5492.42 0 7129 17167 17167 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.3 78.46% 2629.84 2 3319 2631.11 2554 2754 455841 455841 0.00
crit 47.6 21.54% 5238.66 3 6638 5240.40 4933 5596 249265 249265 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 817 2.2% 44.1 6.64sec 5548 0 Direct 44.1 4562 9094 5548 21.8%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.13 44.13 0.00 0.00 0.0000 0.0000 244830.80 244830.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.52 78.24% 4561.87 4180 5756 4564.20 4228 5019 157493 157493 0.00
crit 9.60 21.76% 9093.82 8360 11513 9095.46 8360 11164 87338 87338 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2832 (4483) 7.7% (12.2%) 91.8 3.20sec 14629 16207 Direct 92.4 7638 15254 9188 20.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.84 92.37 0.00 0.00 0.9027 0.0000 848657.41 848657.41 0.00 16206.74 16206.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.57 79.65% 7637.94 6967 9594 7642.58 7364 8057 561897 561897 0.00
crit 18.80 20.35% 15254.03 13933 19188 15261.85 13933 17020 286761 286761 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1651 4.5% 73.5 3.99sec 6735 0 Direct 73.5 6735 0 6735 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.48 73.48 0.00 0.00 0.0000 0.0000 494913.94 494913.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.48 100.00% 6734.92 5086 14007 6738.33 5795 7866 494914 494914 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11999 32.7% 60.6 4.98sec 59322 56411 Direct 60.4 49269 98169 59512 20.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.61 60.41 0.00 0.00 1.0516 0.0000 3595311.97 3595311.97 0.00 56411.21 56411.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.76 79.06% 49269.28 45067 61614 49293.30 47383 51800 2353172 2353172 0.00
crit 12.65 20.94% 98169.20 90135 123227 98209.51 90135 110636 1242140 1242140 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1631 4.5% 12.8 23.58sec 38341 36941 Direct 12.8 2400 4786 2903 21.1%  
Periodic 218.6 1704 3396 2068 21.5% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 218.58 218.58 1.0379 1.3467 488954.24 488954.24 0.00 1589.57 36941.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.06 78.90% 2399.57 2231 3073 2400.41 2231 2661 24143 24143 0.00
crit 2.69 21.10% 4786.29 4463 6146 4548.89 0 6146 12881 12881 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.6 78.53% 1704.24 2 2151 1705.06 1654 1788 292521 292521 0.00
crit 46.9 21.47% 3395.93 8 4302 3397.29 3211 3696 159409 159409 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5813 15.8% 88.3 3.15sec 19630 0 Direct 88.3 16347 32700 19630 20.1%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.26 88.26 0.00 0.00 0.0000 0.0000 1732500.95 1732500.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.54 79.92% 16346.68 15985 17583 16346.53 15985 17220 1153053 1153053 0.00
crit 17.72 20.08% 32700.13 31970 35167 32698.73 31970 34921 579448 579448 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2800 7.6% 18.0 16.59sec 46668 45500 Direct 18.0 3916 7812 4761 21.7%  
Periodic 220.1 2824 5628 3425 21.4% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 17.99 220.07 220.07 1.0257 1.3450 839376.58 839376.58 0.00 2669.31 45499.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.08 78.30% 3915.81 3570 4917 3916.83 3649 4313 55148 55148 0.00
crit 3.90 21.70% 7811.94 7141 9834 7704.45 0 9834 30489 30489 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.9 78.57% 2824.27 4 3565 2825.62 2748 2961 488377 488377 0.00
crit 47.2 21.43% 5627.90 3 7129 5630.00 5329 6118 265363 265363 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1113 3.0% 5.0 67.20sec 67233 60390 Periodic 60.7 1322 6798 5509 76.5% 3.3%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.97 0.00 39.64 60.69 1.1135 0.2500 334321.67 334321.67 0.00 21647.35 60390.48
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.3 23.54% 1321.67 87 1575 1320.34 1028 1549 18884 18884 0.00
crit 46.4 76.46% 6797.59 434 7875 6798.03 6256 7770 315438 315438 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1303.78
  • base_dd_max:1303.78
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.40sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.10sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9013 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.3 44.6sec 5.0sec 92.79% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.27%
  • arcanic_pulsar_2:10.41%
  • arcanic_pulsar_3:11.44%
  • arcanic_pulsar_4:10.55%
  • arcanic_pulsar_5:13.71%
  • arcanic_pulsar_6:10.23%
  • arcanic_pulsar_7:10.82%
  • arcanic_pulsar_8:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.11% 7.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.77% 32.42% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.2sec 45.7sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.2 46.0 9.1sec 3.8sec 82.28% 99.70% 2.0(2.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.67%
  • lunar_empowerment_2:32.03%
  • lunar_empowerment_3:14.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.5sec 34.3sec 47.48% 0.00% 3.4(47.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.90%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.33%
  • overwhelming_power_21:2.40%
  • overwhelming_power_22:2.47%
  • overwhelming_power_23:2.55%
  • overwhelming_power_24:2.62%
  • overwhelming_power_25:1.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 66.7sec 66.7sec 5.30% 0.00% 0.0(0.0) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 84.4 66.8sec 3.3sec 91.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.63%
  • reckless_force_counter_2:5.23%
  • reckless_force_counter_3:5.16%
  • reckless_force_counter_4:5.09%
  • reckless_force_counter_5:5.06%
  • reckless_force_counter_6:5.00%
  • reckless_force_counter_7:4.94%
  • reckless_force_counter_8:4.89%
  • reckless_force_counter_9:4.82%
  • reckless_force_counter_10:4.81%
  • reckless_force_counter_11:4.77%
  • reckless_force_counter_12:4.70%
  • reckless_force_counter_13:4.67%
  • reckless_force_counter_14:4.62%
  • reckless_force_counter_15:4.57%
  • reckless_force_counter_16:4.48%
  • reckless_force_counter_17:4.44%
  • reckless_force_counter_18:4.36%
  • reckless_force_counter_19:4.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.3 51.5 12.2sec 4.0sec 85.80% 79.68% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.82%
  • solar_empowerment_2:40.08%
  • solar_empowerment_3:17.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.4 20.3sec 5.0sec 97.29% 92.18% 15.4(15.4) 11.4

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.53%
  • starlord_2:22.83%
  • starlord_3:59.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.5sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 60.6 2424.3 40.0 40.0 1483.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.84 742.68 (31.12%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.35%) 40.00 0.00 0.00%
sunfire Astral Power 17.99 53.96 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.13 176.50 (7.39%) 4.00 0.01 0.00%
moonfire Astral Power 14.07 42.22 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.02 (4.27%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.22 914.57 (38.32%) 12.00 0.06 0.01%
natures_balance Astral Power 400.63 200.31 (8.39%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.21 74.55 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.95 8.08
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.20 0.00 70.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data unbound force Damage Per Second
Count 7806
Mean 36674.72
Minimum 33330.16
Maximum 41538.00
Spread ( max - min ) 8207.84
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 1109.4805
5th Percentile 34911.62
95th Percentile 38558.59
( 95th Percentile - 5th Percentile ) 3646.98
Mean Distribution
Standard Deviation 12.5576
95.00% Confidence Intervall ( 36650.11 - 36699.33 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3516
0.1 Scale Factor Error with Delta=300 10509
0.05 Scale Factor Error with Delta=300 42033
0.01 Scale Factor Error with Delta=300 1050808
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 7806
Mean 36674.72
Minimum 33330.16
Maximum 41538.00
Spread ( max - min ) 8207.84
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 1109.4805
5th Percentile 34911.62
95th Percentile 38558.59
( 95th Percentile - 5th Percentile ) 3646.98
Mean Distribution
Standard Deviation 12.5576
95.00% Confidence Intervall ( 36650.11 - 36699.33 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3516
0.1 Scale Factor Error with Delta=300 10509
0.05 Scale Factor Error with Delta=300 42033
0.01 Scale Factor Error with Delta=300 1050808
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 7806
Mean 36674.72
Minimum 33330.16
Maximum 41538.00
Spread ( max - min ) 8207.84
Range [ ( max - min ) / 2 * 100% ] 11.19%
Damage
Sample Data unbound force Damage
Count 7806
Mean 10982658.91
Minimum 8552931.10
Maximum 13740893.28
Spread ( max - min ) 5187962.19
Range [ ( max - min ) / 2 * 100% ] 23.62%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
H 4.97 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.90 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.61 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.07 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.54 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.29 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.58 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.10 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.38 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQKRQRQNRORQRJKRKPRLQKQQQRRQRKRKRQRQRJKKONQPQKRQKRQRQRRRKKNOQKRQPRQRRQKNRQKRKOQKQHRQPQKNRQRQKROQKRQKRNQRKPRQRQRGKRKRQRKMNRQKRQQRRPRRJKKQQKONRQQRKRQRQRRKKPHRQKLOQRQQQRJKRKRIEFNRKPRQKORQRKRQRQRKRKLQKRQRKPMQRQQRJKNQKHRQKRQQKOPRNQKRGQKRQQRKQRRRRNORRJKPKRQKRLQKQQQKHRQORKQPNRRKQRRRKQRQRRKONQKPKRQRLQKRQRRRKOQKQRRRKQRRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.247 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.210 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.143 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.076 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.009 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.823 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.823 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.823 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.578 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.334 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:08.090 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:08.845 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:09.698 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:10.452 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.207 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.961 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.719 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.473 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.227 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(4), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.981 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.736 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(19), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.489 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.244 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.999 default O moonfire Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.752 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.508 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.285 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.041 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.041 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(21), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.794 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.548 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20), reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.302 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), reckless_force_counter(6), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.059 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), reckless_force_counter(6), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.815 default L sunfire Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(18), reckless_force_counter(6), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.569 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), starlord(2), overwhelming_power(17), reckless_force_counter(6), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.475 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), starlord(2), overwhelming_power(16), reckless_force_counter(6)
0:27.331 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), reckless_force_counter(6)
0:28.393 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), reckless_force_counter(7)
0:29.460 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(7)
0:30.531 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(7)
0:31.285 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(11), reckless_force_counter(7)
0:32.133 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(10), reckless_force_counter(7)
0:33.215 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(9), reckless_force_counter(7)
0:33.970 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(9), reckless_force_counter(7)
0:34.824 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25), reckless_force_counter(7)
0:35.579 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(8)
0:36.334 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(9)
0:37.089 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(9)
0:37.991 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(9)
0:38.745 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(9)
0:39.649 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(9)
0:40.405 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), reckless_force_counter(9)
0:40.405 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(19), reckless_force_counter(9)
0:41.185 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter(9)
0:42.321 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter(9)
0:43.428 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), reckless_force_counter(10)
0:44.536 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(10)
0:45.956 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), reckless_force_counter(11)
0:47.075 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(12), reckless_force_counter(11)
0:48.509 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), reckless_force_counter(12)
0:49.640 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(12)
0:50.578 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(12)
0:51.990 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), reckless_force_counter(12)
0:53.103 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6), reckless_force_counter(13)
0:54.056 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(13)
0:55.488 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(13)
0:56.449 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(13)
0:57.895 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), reckless_force_counter(13)
0:58.861 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(13)
0:59.831 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, reckless_force_counter(14)
1:00.977 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(5), torrent_of_elements, reckless_force_counter(14)
1:02.226 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(15)
1:03.437 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(15)
1:04.616 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(15)
1:05.794 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(16)
1:07.295 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(17)
1:08.470 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(17)
1:09.441 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(17), conch_of_dark_whispers
1:10.902 default P stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(17), conch_of_dark_whispers
1:12.047 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(17), conch_of_dark_whispers
1:13.022 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(17), conch_of_dark_whispers
1:14.483 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:15.457 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:16.430 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:17.891 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:19.037 default N sunfire Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:20.032 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:20.878 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(18), conch_of_dark_whispers
1:22.146 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power celestial_alignment, lunar_empowerment, reckless_force_counter(18), conch_of_dark_whispers
1:23.233 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(19), conch_of_dark_whispers
1:24.128 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, reckless_force_counter(19), conch_of_dark_whispers
1:25.183 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), reckless_force_counter(19)
1:26.361 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), reckless_force_counter(19)
1:27.861 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(19)
1:29.039 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(19)
1:30.499 default H the_unbound_force Fluffy_Pillow 15.0/100: 15% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:31.645 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:32.618 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:34.078 default P stellar_flare Fluffy_Pillow 41.5/100: 42% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:35.224 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:36.684 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter
1:37.829 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter
1:38.975 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter
1:39.950 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter
1:41.409 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter
1:42.382 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), reckless_force_counter(2)
1:43.974 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), reckless_force_counter(2)
1:45.223 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord, reckless_force_counter(3)
1:46.253 default O moonfire Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(3)
1:47.466 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(3)
1:49.010 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(5)
1:50.224 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(5)
1:51.225 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(5)
1:52.726 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(5)
1:53.904 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(6)
1:54.878 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(6)
1:56.025 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(6)
1:57.485 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), reckless_force_counter(6)
1:58.379 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(6)
1:59.433 default P stellar_flare Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), reckless_force_counter(7)
2:00.490 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(7)
2:01.393 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(7)
2:02.751 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), reckless_force_counter(7)
2:03.662 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(8)
2:05.028 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), solar_empowerment(3), overwhelming_power(16), reckless_force_counter(8)
2:06.029 default G use_items Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), solar_empowerment(2), overwhelming_power(15), reckless_force_counter(9)
2:06.029 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), solar_empowerment(2), overwhelming_power(15), reckless_force_counter(9), ignition_mages_fuse
2:07.166 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(14), reckless_force_counter(9), ignition_mages_fuse
2:07.985 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14), reckless_force_counter(9), ignition_mages_fuse
2:08.949 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13), reckless_force_counter(9), ignition_mages_fuse
2:09.749 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), reckless_force_counter(9), ignition_mages_fuse
2:10.947 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11), reckless_force_counter(9), ignition_mages_fuse(2)
2:11.722 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), reckless_force_counter(9), ignition_mages_fuse(2)
2:12.636 default M moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(9), ignition_mages_fuse(2)
2:13.527 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), reckless_force_counter(9), ignition_mages_fuse(2)
2:14.555 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), reckless_force_counter(9), ignition_mages_fuse(3)
2:15.401 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter(10), ignition_mages_fuse(3)
2:16.595 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(11), ignition_mages_fuse(3)
2:17.537 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), reckless_force_counter(11), ignition_mages_fuse(3)
2:18.339 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(11), ignition_mages_fuse(4)
2:19.504 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(11), ignition_mages_fuse(4)
2:20.672 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), overwhelming_power(20), reckless_force_counter(11), ignition_mages_fuse(4)
2:21.454 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(11), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.238 default P stellar_flare Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(11), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.135 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.899 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.797 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(16), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.797 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(3), lunar_empowerment, overwhelming_power(16), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.779 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15), reckless_force_counter(12), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.735 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), reckless_force_counter(12), conch_of_dark_whispers
2:28.159 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), reckless_force_counter(13), conch_of_dark_whispers
2:29.594 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), reckless_force_counter(13), conch_of_dark_whispers
2:30.726 default O moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), reckless_force_counter(13), conch_of_dark_whispers
2:31.829 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(13), conch_of_dark_whispers
2:32.936 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), reckless_force_counter(14), conch_of_dark_whispers
2:33.883 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(14), conch_of_dark_whispers
2:35.306 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(14), conch_of_dark_whispers
2:36.740 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(4), reckless_force_counter(14)
2:37.699 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), reckless_force_counter(14)
2:38.832 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), reckless_force_counter(15)
2:39.799 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, reckless_force_counter(15)
2:41.253 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(16)
2:42.227 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(17)
2:43.686 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(17)
2:44.660 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(18)
2:45.635 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(7), lunar_empowerment, reckless_force_counter(18)
2:46.885 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(19)
2:48.097 default P stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), reckless_force_counter(19)
2:49.122 default H the_unbound_force Fluffy_Pillow 24.5/100: 25% astral_power reckless_force, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2)
2:50.147 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power reckless_force, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2)
2:51.020 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power reckless_force, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
2:52.325 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power reckless_force, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
2:53.348 default L sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:54.343 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2)
2:55.489 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(3)
2:56.948 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(3)
2:57.921 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(3)
2:59.381 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4)
3:00.842 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(5), conch_of_dark_whispers
3:02.302 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(5), conch_of_dark_whispers
3:03.277 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(5), conch_of_dark_whispers
3:03.277 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar, solar_empowerment(2), torrent_of_elements, reckless_force_counter(5), conch_of_dark_whispers
3:04.525 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, reckless_force_counter(5), conch_of_dark_whispers
3:05.554 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(7), conch_of_dark_whispers
3:06.767 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(8), conch_of_dark_whispers
3:07.769 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), reckless_force_counter(8), conch_of_dark_whispers
3:08.706 default E potion Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), reckless_force_counter(9), conch_of_dark_whispers
3:08.706 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:08.706 default N sunfire Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:09.559 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:10.313 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:11.174 default P stellar_flare Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:12.016 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:12.770 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:13.844 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:14.689 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(18), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:15.536 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(17), reckless_force_counter(11), conch_of_dark_whispers, battle_potion_of_intellect
3:16.290 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(11), battle_potion_of_intellect
3:17.380 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(12), battle_potion_of_intellect
3:18.135 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), reckless_force_counter(12), battle_potion_of_intellect
3:18.997 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(12), battle_potion_of_intellect
3:19.751 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(12), battle_potion_of_intellect
3:20.853 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(12), battle_potion_of_intellect
3:21.663 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(13), battle_potion_of_intellect
3:22.881 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(10), reckless_force_counter(13), battle_potion_of_intellect
3:23.842 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, overwhelming_power(9), reckless_force_counter(14), battle_potion_of_intellect
3:24.893 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), reckless_force_counter(14), battle_potion_of_intellect
3:25.764 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(7), reckless_force_counter(16), battle_potion_of_intellect
3:26.790 default L sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(6), reckless_force_counter(16), battle_potion_of_intellect
3:27.794 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(5), reckless_force_counter(16), battle_potion_of_intellect
3:29.266 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(3), reckless_force_counter(16), battle_potion_of_intellect
3:30.432 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(2), reckless_force_counter(16), battle_potion_of_intellect
3:31.273 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power, reckless_force_counter(16), battle_potion_of_intellect
3:32.537 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(17), battle_potion_of_intellect
3:33.385 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(18), battle_potion_of_intellect
3:34.381 default P stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(18)
3:35.376 default M moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(18)
3:36.373 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(18)
3:37.834 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(18)
3:38.809 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(19)
3:40.268 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(19)
3:41.730 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), reckless_force_counter(19)
3:42.704 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(19)
3:42.704 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, reckless_force_counter(19)
3:43.952 default N sunfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(19)
3:45.165 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(19)
3:46.709 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(19)
3:47.922 default H the_unbound_force Fluffy_Pillow 29.0/100: 29% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:49.100 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:50.102 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter
3:51.602 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter
3:52.780 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter
3:53.753 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter
3:55.210 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter
3:56.669 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter
3:57.816 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(2)
3:58.961 default P stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(2)
4:00.107 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(2)
4:01.081 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(2)
4:02.227 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(3)
4:03.685 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), reckless_force_counter(4)
4:04.932 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, reckless_force_counter(4)
4:05.962 default G use_items Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(4)
4:05.962 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(4), ignition_mages_fuse
4:07.444 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(4), ignition_mages_fuse
4:08.606 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(6), ignition_mages_fuse
4:09.568 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(6), ignition_mages_fuse
4:11.007 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(6), ignition_mages_fuse(2)
4:12.391 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), reckless_force_counter(6), ignition_mages_fuse(2)
4:13.313 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(6), ignition_mages_fuse(2)
4:14.399 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), ignition_mages_fuse(3)
4:15.695 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(9), ignition_mages_fuse(3)
4:16.560 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(9), ignition_mages_fuse(3)
4:17.424 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(10), ignition_mages_fuse(3)
4:18.439 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(11), ignition_mages_fuse(4)
4:19.419 default N sunfire Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(11), ignition_mages_fuse(4)
4:20.400 default O moonfire Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(4)
4:21.379 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(4)
4:22.358 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(5)
4:23.302 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(5)
4:23.302 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(5)
4:24.332 default P stellar_flare Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(5)
4:25.203 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), reckless_force_counter(13), ignition_mages_fuse(5)
4:26.013 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), reckless_force_counter(14)
4:26.817 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), reckless_force_counter(15)
4:28.015 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21), reckless_force_counter(15)
4:28.965 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(15)
4:29.750 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(15)
4:30.677 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), reckless_force_counter(15)
4:32.040 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(16)
4:33.116 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(16)
4:34.490 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(17)
4:35.871 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(18)
4:37.257 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(12), reckless_force_counter(19), conch_of_dark_whispers
4:38.354 default H the_unbound_force Fluffy_Pillow 6.0/100: 6% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), conch_of_dark_whispers
4:39.454 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), conch_of_dark_whispers
4:40.393 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
4:41.805 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power reckless_force, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
4:42.917 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
4:43.866 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, overwhelming_power(6), conch_of_dark_whispers
4:45.086 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4), conch_of_dark_whispers
4:46.608 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, overwhelming_power(3), reckless_force_counter, conch_of_dark_whispers
4:47.807 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, overwhelming_power(2), reckless_force_counter, conch_of_dark_whispers
4:49.009 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, reckless_force_counter, conch_of_dark_whispers
4:50.040 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, reckless_force_counter, conch_of_dark_whispers
4:51.070 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord, reckless_force_counter, conch_of_dark_whispers
4:52.283 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(2)
4:53.784 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(2)
4:54.785 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), reckless_force_counter(2)
4:55.785 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), starlord(2), reckless_force_counter(2)
4:56.961 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(2), reckless_force_counter(3)
4:58.139 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(3)
4:59.599 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(3)
5:00.572 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), reckless_force_counter(4)
5:02.031 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(4)
5:03.178 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(4)
5:04.323 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), reckless_force_counter(4)
5:05.572 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(4)
5:06.783 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(6)
5:07.996 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(6)
5:09.542 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), solar_empowerment, starlord, reckless_force_counter(6)
5:10.755 default P stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(6)
5:11.781 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(8)
5:12.804 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(8)
5:13.652 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(8)
5:14.924 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(8)
5:15.772 default L sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(8)
5:16.767 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(10)
5:18.225 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers
5:19.371 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(11), conch_of_dark_whispers
5:20.342 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(11), conch_of_dark_whispers
5:21.802 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers
5:22.775 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers
5:23.749 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, reckless_force_counter(12), conch_of_dark_whispers
5:24.894 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
5:26.142 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
5:27.355 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
5:28.899 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:30.111 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:31.610 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
5:32.612 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
5:33.615 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), reckless_force_counter(15), conch_of_dark_whispers
5:34.616 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), starlord(2), reckless_force_counter(15), conch_of_dark_whispers
5:35.792 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(15), conch_of_dark_whispers
5:37.251 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), reckless_force_counter(16)
5:38.224 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), starlord(3), reckless_force_counter(16)
5:39.369 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(3), reckless_force_counter(16)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

visions : 39547 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39547.0 39547.0 39.5 / 0.100% 7069.7 / 17.9% 4624.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.4 Astral Power 0.00% 58.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 39547
Heed My Call 302 (431) 0.8% (1.1%) 8.3 32.88sec 15498 0 Direct 8.3 9193 18378 10855 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.35 8.35 0.00 0.00 0.0000 0.0000 90628.93 90628.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.84 81.91% 9193.14 8987 9886 9187.87 0 9886 62872 62872 0.00
crit 1.51 18.09% 18377.55 17974 19771 14334.34 0 19771 27757 27757 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.3 32.88sec 4644 0 Direct 8.3 3940 7878 4644 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.35 8.35 0.00 0.00 0.0000 0.0000 38770.61 38770.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.86 82.13% 3939.65 3852 4237 3938.56 0 4237 27015 27015 0.00
crit 1.49 17.87% 7878.49 7703 8473 6149.10 0 8473 11755 11755 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5285 13.4% 79.0 3.72sec 20066 15566 Direct 79.0 17001 33991 20067 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.99 78.99 0.00 0.00 1.2892 0.0000 1585092.24 1585092.24 0.00 15565.76 15565.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.74 81.96% 17000.77 8968 21459 17002.07 16214 17933 1100614 1100614 0.00
crit 14.25 18.04% 33990.66 17937 42918 33994.23 29490 38140 484478 484478 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2565 6.5% 14.3 21.19sec 53917 53462 Direct 14.3 2906 5810 3421 17.7%  
Periodic 225.8 2705 5408 3191 18.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 225.79 225.79 1.0086 1.3194 769263.62 769263.62 0.00 2463.34 53461.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.74 82.27% 2905.86 2614 3599 2906.06 2668 3139 34107 34107 0.00
crit 2.53 17.73% 5810.25 5227 7198 5457.57 0 7198 14701 14701 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.2 82.01% 2704.63 2 3351 2704.83 2613 2850 500812 500812 0.00
crit 40.6 17.99% 5407.52 3 6702 5407.65 5028 5858 219644 219644 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 831 2.1% 45.0 6.53sec 5537 0 Direct 45.0 4694 9385 5537 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.02 45.02 0.00 0.00 0.0000 0.0000 249304.51 249304.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.93 82.02% 4693.79 4220 5812 4694.15 4385 5135 173329 173329 0.00
crit 8.10 17.98% 9385.42 8441 11624 9382.12 0 11624 75976 75976 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2946 (4702) 7.4% (11.9%) 94.5 3.12sec 14922 16822 Direct 95.1 7883 15761 9293 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.54 95.10 0.00 0.00 0.8871 0.0000 883727.77 883727.77 0.00 16822.43 16822.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.07 82.10% 7882.80 7034 9687 7884.24 7598 8348 615427 615427 0.00
crit 17.02 17.90% 15760.79 14068 19373 15763.56 14334 17666 268301 268301 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1756 4.4% 77.5 3.79sec 6800 0 Direct 77.5 6800 0 6800 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.51 77.51 0.00 0.00 0.0000 0.0000 527068.28 527068.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.51 100.00% 6799.85 5135 14142 6798.97 5976 8029 527068 527068 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5905.03
  • base_dd_max:5905.03
  • base_dd_mult:1.00
 
Starsurge 12725 32.2% 64.2 4.73sec 59504 57537 Direct 63.9 50706 101352 59726 17.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.16 63.92 0.00 0.00 1.0342 0.0000 3817714.57 3817714.57 0.00 57537.29 57537.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.53 82.19% 50706.31 45503 62210 50704.22 48633 53639 2663824 2663824 0.00
crit 11.38 17.81% 101352.29 91007 124420 101340.74 91007 118222 1153890 1153890 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1664 4.2% 12.8 23.57sec 39005 37791 Direct 12.8 2474 4946 2919 18.0%  
Periodic 223.4 1753 3503 2067 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 223.39 223.39 1.0321 1.3221 499111.17 499111.17 0.00 1617.64 37791.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 82.02% 2474.09 2253 3103 2474.52 2253 2759 25965 25965 0.00
crit 2.30 17.98% 4946.03 4506 6205 4537.88 0 6205 11382 11382 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.3 82.05% 1752.94 6 2172 1753.05 1697 1838 321312 321312 0.00
crit 40.1 17.95% 3503.38 162 4344 3503.57 3263 3768 140452 140452 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8491 21.5% 131.0 2.20sec 19473 0 Direct 131.0 16515 33031 19473 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.02 131.02 0.00 0.00 0.0000 0.0000 2551328.52 2551328.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.55 82.09% 16515.18 16140 17753 16514.31 16140 17310 1776282 1776282 0.00
crit 23.46 17.91% 33030.60 32279 35507 33031.75 32279 34827 775046 775046 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2854 7.2% 18.0 16.69sec 47551 47102 Direct 18.0 4019 8038 4737 17.9%  
Periodic 224.9 2905 5807 3427 18.0% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.00 18.00 224.90 224.90 1.0096 1.3204 856079.04 856079.04 0.00 2716.50 47102.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.78 82.12% 4018.79 3605 4964 4018.76 3757 4355 59417 59417 0.00
crit 3.22 17.88% 8038.07 7210 9929 7796.02 0 9929 25871 25871 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.4 82.01% 2905.00 2 3599 2905.23 2812 3055 535787 535787 0.00
crit 40.5 17.99% 5807.25 3 7198 5807.27 5383 6315 235004 235004 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 188.44sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.4 154.57sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.9081 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.388
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.4 42.5sec 4.7sec 93.08% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.30%
  • arcanic_pulsar_2:10.85%
  • arcanic_pulsar_3:11.50%
  • arcanic_pulsar_4:10.76%
  • arcanic_pulsar_5:13.09%
  • arcanic_pulsar_6:11.04%
  • arcanic_pulsar_7:11.07%
  • arcanic_pulsar_8:13.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 111.4sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 188.6sec 188.6sec 8.11% 8.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 10.0 0.0 31.1sec 31.1sec 38.77% 46.50% 0.0(0.0) 9.5

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:38.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.62% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.4 0.0 154.6sec 154.6sec 15.20% 0.00% 2.2(2.2) 2.2

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:3.00%
  • ignition_mages_fuse_5:2.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 28.9 54.3 10.4sec 3.6sec 85.77% 98.95% 3.3(3.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:32.14%
  • lunar_empowerment_2:32.91%
  • lunar_empowerment_3:20.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.6sec 33.7sec 48.13% 0.00% 3.5(49.2) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.9 52.0 10.6sec 3.8sec 84.77% 81.60% 0.3(0.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.42%
  • solar_empowerment_2:38.12%
  • solar_empowerment_3:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 48.8 20.1sec 4.7sec 97.96% 92.98% 18.3(18.3) 10.7

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.11%
  • starlord_2:21.99%
  • starlord_3:61.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.59% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.59%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.0 0.6 61.2sec 51.3sec 14.11% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:116.09

Stack Uptimes

  • vision_of_perfection_1:14.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 64.2 2566.3 40.0 40.0 1487.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.54 763.79 (30.19%) 7.99 0.55 0.07%
celestial_alignment Astral Power 2.37 95.00 (3.75%) 40.00 0.00 0.00%
sunfire Astral Power 18.00 54.01 (2.13%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.02 180.05 (7.12%) 4.00 0.04 0.02%
moonfire Astral Power 14.27 42.80 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.34 (4.05%) 8.00 0.02 0.02%
lunar_strike Astral Power 78.99 947.32 (37.44%) 11.99 0.58 0.06%
natures_balance Astral Power 400.63 200.30 (7.92%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.66 79.92 (3.16%) 12.00 0.00 0.00%
vision_of_perfection Astral Power 4.62 64.58 (2.55%) 13.97 0.12 0.18%
Resource RPS-Gain RPS-Loss
Astral Power 8.43 8.55
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.50 0.00 92.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data visions Damage Per Second
Count 7806
Mean 39547.00
Minimum 34244.53
Maximum 47437.39
Spread ( max - min ) 13192.85
Range [ ( max - min ) / 2 * 100% ] 16.68%
Standard Deviation 1782.0486
5th Percentile 36816.45
95th Percentile 42618.85
( 95th Percentile - 5th Percentile ) 5802.40
Mean Distribution
Standard Deviation 20.1700
95.00% Confidence Intervall ( 39507.47 - 39586.54 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7801
0.1 Scale Factor Error with Delta=300 27110
0.05 Scale Factor Error with Delta=300 108439
0.01 Scale Factor Error with Delta=300 2710958
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 7806
Mean 39547.00
Minimum 34244.53
Maximum 47437.39
Spread ( max - min ) 13192.85
Range [ ( max - min ) / 2 * 100% ] 16.68%
Standard Deviation 1782.0486
5th Percentile 36816.45
95th Percentile 42618.85
( 95th Percentile - 5th Percentile ) 5802.40
Mean Distribution
Standard Deviation 20.1700
95.00% Confidence Intervall ( 39507.47 - 39586.54 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7801
0.1 Scale Factor Error with Delta=300 27110
0.05 Scale Factor Error with Delta=300 108439
0.01 Scale Factor Error with Delta=300 2710958
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 7806
Mean 39547.00
Minimum 34244.53
Maximum 47437.39
Spread ( max - min ) 13192.85
Range [ ( max - min ) / 2 * 100% ] 16.68%
Damage
Sample Data visions Damage
Count 7806
Mean 11868089.26
Minimum 8710933.29
Maximum 16035738.19
Spread ( max - min ) 7324804.90
Range [ ( max - min ) / 2 * 100% ] 30.86%
DTPS
Sample Data visions Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.37 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.38 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.75 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.16 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.65 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.17 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.81 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.10 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 79.30 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.79 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.54 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPJQPQPJQPMQPNQPQJOJQPJPPQQQPQQQJMJQPQRQIJNJQPQPJOPPJQPJQMPPQJNQPQJQOPJQPJQPKEQPJQPJNQPJQPJMOQPQPQLQJJPQPJQMPPQQQOQIJQJQPJLPMPJQPPPQQIJJOPNMQPJQPJQPPHGIJQJQPQJMNOQPJQPJQPQPQPQJQPJMQFQPJQPJLOPPQPQIJJMQPJQLPPQJQPJOQPQPJQJMPPQJNQPQPQQMOQJJPPQJQPJQPLQMQQPQJJOPPQJQPMNQJQPQQJPQJOPQJMQPNPQQQQJQPJQPJMOPHGJQPNJQPQPIJQPQJQMQPJQPJQPOQPQIJJQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.247 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.115 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.050 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.863 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.863 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.863 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.618 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.373 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.126 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.883 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.737 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.491 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.245 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.003 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.757 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.519 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.273 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.027 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.782 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.535 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.291 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.048 default N moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.801 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.558 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.354 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.109 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.863 default O stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.617 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.371 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.126 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
0:23.929 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
0:24.686 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(5)
0:25.589 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8)
0:26.680 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
0:27.436 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6)
0:28.190 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(5)
0:29.055 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4)
0:30.163 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(3)
0:31.037 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(2)
0:31.914 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(2)
0:32.789 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power
0:33.668 default M sunfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection
0:34.427 default J starsurge Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), vision_of_perfection
0:35.184 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection
0:35.940 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection
0:36.903 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), vision_of_perfection
0:37.658 default R sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers
0:38.414 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers
0:39.169 default I cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers
0:39.169 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, vision_of_perfection, conch_of_dark_whispers
0:39.993 default N moonfire Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, vision_of_perfection, conch_of_dark_whispers
0:40.795 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, vision_of_perfection, conch_of_dark_whispers
0:41.596 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), vision_of_perfection, conch_of_dark_whispers
0:42.456 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(25), vision_of_perfection, conch_of_dark_whispers
0:43.633 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
0:44.431 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers
0:45.632 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), conch_of_dark_whispers
0:46.579 default O stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:47.640 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:48.998 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:50.359 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:51.436 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:52.355 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:53.736 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
0:54.824 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
0:55.751 default M sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
0:56.848 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:58.249 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
0:59.660 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(3), overwhelming_power(8)
1:00.691 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(6), solar_empowerment(2), overwhelming_power(7)
1:01.909 default N moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(6)
1:03.095 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(4)
1:04.111 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(3)
1:05.637 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord, overwhelming_power(2)
1:06.663 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power
1:07.872 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:08.872 default O stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:10.050 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:11.550 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:12.727 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:13.575 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:14.844 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:15.841 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:16.686 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:17.956 default K sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:18.952 default E potion Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers
1:18.952 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:19.787 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:21.039 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:22.112 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:22.996 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, vision_of_perfection, battle_potion_of_intellect
1:24.319 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, vision_of_perfection, battle_potion_of_intellect
1:25.359 default N moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), vision_of_perfection, battle_potion_of_intellect
1:26.369 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), vision_of_perfection, battle_potion_of_intellect
1:27.229 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:28.516 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:29.528 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:30.362 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:31.613 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:32.597 default M sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:33.579 default O stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:34.562 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:35.397 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:36.651 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:37.488 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:38.739 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:39.575 default L moonfire Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:40.556 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
1:41.699 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(5), lunar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect
1:42.949 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
1:44.162 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:45.663 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:46.664 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:48.164 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:49.342 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:50.316 default M sunfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:51.462 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:52.921 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:54.380 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
1:55.353 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
1:56.326 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:57.474 default O stellar_flare Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:58.620 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:59.766 default I cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements
1:59.766 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements
2:01.015 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
2:01.912 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:02.966 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
2:03.837 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:05.144 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:06.169 default L moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:07.165 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:08.624 default M sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:09.771 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:11.230 default J starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:12.377 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:13.351 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:14.811 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:16.270 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
2:17.730 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
2:18.706 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
2:19.680 default I cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(3), starlord(3)
2:19.680 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(3)
2:20.930 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
2:22.143 default O stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:23.320 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:24.819 default N moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2)
2:25.998 default M sunfire Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2)
2:27.176 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2)
2:28.177 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25)
2:29.548 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
2:30.627 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
2:31.523 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
2:32.871 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
2:33.933 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
2:34.837 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
2:36.197 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
2:37.568 default H celestial_alignment Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(16)
2:38.510 default G use_items Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(15)
2:38.510 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(15), ignition_mages_fuse
2:38.510 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(3), overwhelming_power(15), ignition_mages_fuse
2:39.498 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(14), ignition_mages_fuse
2:40.318 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(13), ignition_mages_fuse
2:41.283 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(12), ignition_mages_fuse
2:42.083 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse
2:43.286 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(2)
2:44.063 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(2)
2:44.979 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(2)
2:45.826 default N moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(2)
2:46.675 default O stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(3)
2:47.497 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(3)
2:48.251 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(3)
2:49.303 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(3)
2:50.134 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), vision_of_perfection, ignition_mages_fuse(3)
2:50.890 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), vision_of_perfection, ignition_mages_fuse(4)
2:51.902 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), vision_of_perfection, ignition_mages_fuse(4)
2:52.698 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), vision_of_perfection, ignition_mages_fuse(4)
2:53.453 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), vision_of_perfection, ignition_mages_fuse(4)
2:54.473 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), vision_of_perfection, ignition_mages_fuse(4)
2:55.226 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), vision_of_perfection, ignition_mages_fuse(5)
2:56.220 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), vision_of_perfection, ignition_mages_fuse(5)
2:56.977 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), vision_of_perfection, ignition_mages_fuse(5)
2:57.973 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), vision_of_perfection, ignition_mages_fuse(5)
2:58.727 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(11), vision_of_perfection
2:59.759 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
3:00.624 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(9)
3:01.921 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8)
3:02.944 default M sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(25)
3:03.883 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24)
3:04.683 default F berserking Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(23)
3:04.863 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(23)
3:05.721 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(22)
3:06.818 default J starsurge Fluffy_Pillow 75.5/100: 76% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(21)
3:07.683 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20)
3:08.437 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(19)
3:09.513 default J starsurge Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18)
3:10.363 default L moonfire Fluffy_Pillow 17.5/100: 18% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17)
3:11.214 default O stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power berserking, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16)
3:12.197 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power berserking, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:13.454 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
3:14.714 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
3:15.560 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
3:16.772 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(24)
3:17.585 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(23)
3:17.585 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), solar_empowerment, overwhelming_power(23)
3:18.732 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22)
3:19.851 default M sunfire Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24)
3:20.789 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(23)
3:21.592 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22)
3:22.798 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21)
3:23.747 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20)
3:24.534 default L moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
3:25.465 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
3:26.832 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:28.202 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
3:29.126 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
3:30.213 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
3:31.141 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
3:32.536 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
3:33.638 default O stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
3:34.743 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), vision_of_perfection, conch_of_dark_whispers
3:35.553 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), vision_of_perfection, conch_of_dark_whispers
3:36.767 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(7), vision_of_perfection, conch_of_dark_whispers
3:37.581 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(6), vision_of_perfection, conch_of_dark_whispers
3:39.023 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, overwhelming_power(4), vision_of_perfection, conch_of_dark_whispers
3:40.078 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(3), vision_of_perfection, conch_of_dark_whispers
3:40.952 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(3), vision_of_perfection
3:41.981 default M sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(2), vision_of_perfection
3:43.133 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), vision_of_perfection
3:44.612 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:46.113 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2)
3:47.116 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
3:48.293 default N moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:49.439 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:50.413 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:51.875 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
3:52.848 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
3:54.307 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
3:55.279 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
3:56.251 default M sunfire Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), starlord(3)
3:57.398 default O stellar_flare Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(6), starlord(3)
3:58.545 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(6), starlord(3)
3:59.691 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(6), conch_of_dark_whispers
4:00.939 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
4:02.153 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:03.655 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:05.155 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:06.157 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
4:07.335 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:08.182 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:09.452 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:10.448 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:11.295 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:12.565 default L moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:13.561 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:14.535 default M sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:15.680 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
4:16.654 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(3), torrent_of_elements
4:17.798 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements
4:19.258 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar, starlord(3), torrent_of_elements
4:20.404 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar
4:21.653 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
4:22.863 default O stellar_flare Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:24.040 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:25.541 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
4:27.042 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2)
4:28.043 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
4:29.221 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:30.197 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:31.658 default M sunfire Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
4:32.805 default N moonfire Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
4:33.950 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
4:34.923 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
4:36.069 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
4:37.042 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
4:38.501 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3)
4:39.475 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
4:40.448 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), solar_empowerment
4:41.695 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
4:43.238 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord
4:44.267 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
4:45.481 default O stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:46.658 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:48.160 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
4:49.160 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
4:50.337 default M sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:51.482 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:52.456 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:53.914 default N moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
4:55.060 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
4:56.521 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
4:57.493 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
4:58.467 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
4:59.613 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
5:00.760 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements
5:02.009 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
5:02.907 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(25)
5:04.135 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(23)
5:05.106 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22)
5:05.912 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
5:07.117 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
5:08.058 default M sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
5:09.111 default O stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
5:10.168 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
5:11.519 default H celestial_alignment Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
5:12.446 default G use_items Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
5:12.446 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
5:13.339 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(18), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse
5:14.091 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse
5:15.196 default N moonfire Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse
5:16.067 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse
5:16.942 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse(2)
5:17.694 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse(2)
5:18.771 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse(2)
5:19.524 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse(2)
5:20.609 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse(3)
5:20.609 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(18), vision_of_perfection, conch_of_dark_whispers, ignition_mages_fuse(3)
5:21.509 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(17), vision_of_perfection, ignition_mages_fuse(3)
5:22.264 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), vision_of_perfection, ignition_mages_fuse(3)
5:23.383 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(3)
5:24.141 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14), ignition_mages_fuse(3)
5:25.037 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(4)
5:25.793 default M sunfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(4)
5:26.632 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(4)
5:27.385 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(4)
5:28.465 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
5:29.286 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(5)
5:30.041 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(5)
5:31.063 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(5)
5:31.870 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), ignition_mages_fuse(5)
5:32.625 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(24)
5:33.790 default O stellar_flare Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23)
5:34.707 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22)
5:35.630 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21)
5:36.806 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20)
5:37.732 default I cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19)
5:37.732 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, overwhelming_power(19)
5:38.743 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18)
5:39.731 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 5.59% 5.59% 475
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

worldvein : 36700 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36700.2 36700.2 25.0 / 0.068% 4396.0 / 12.0% 4543.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 36700
Heed My Call 291 (416) 0.8% (1.1%) 8.1 33.53sec 15329 0 Direct 8.1 9106 18211 10739 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.13 8.13 0.00 0.00 0.0000 0.0000 87351.73 87351.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 82.07% 9106.09 8901 9791 9105.58 0 9791 60796 60796 0.00
crit 1.46 17.93% 18211.10 17802 19582 13932.73 0 19582 26556 26556 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 124 0.3% 8.1 33.53sec 4590 0 Direct 8.1 3902 7807 4590 17.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.13 8.13 0.00 0.00 0.0000 0.0000 37340.43 37340.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.38% 3902.32 3815 4196 3902.10 0 4196 26151 26151 0.00
crit 1.43 17.62% 7807.46 7629 8392 5978.78 0 8392 11189 11189 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5326 14.5% 76.1 3.85sec 20988 16030 Direct 76.1 17795 35571 20988 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.08 76.08 0.00 0.00 1.3093 0.0000 1596830.98 1596830.98 0.00 16030.19 16030.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.42 82.04% 17794.72 9215 22717 17801.52 17174 18901 1110693 1110693 0.00
crit 13.67 17.96% 35571.14 18430 45434 35586.55 31991 40369 486138 486138 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2618 7.1% 14.1 21.32sec 55707 54527 Direct 14.1 3059 6113 3609 18.0%  
Periodic 220.8 2818 5631 3323 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 220.85 220.85 1.0217 1.3444 784590.12 784590.12 0.00 2520.50 54527.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 81.97% 3058.53 2637 3810 3060.59 2837 3390 35312 35312 0.00
crit 2.54 18.03% 6113.23 5274 7620 5755.78 0 7620 15520 15520 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.2 82.06% 2817.87 2 3547 2819.10 2734 2929 510674 510674 0.00
crit 39.6 17.94% 5630.80 32 7095 5633.19 5312 6079 223084 223084 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 847 2.3% 44.0 6.62sec 5769 0 Direct 44.0 4891 9770 5769 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.03 44.03 0.00 0.00 0.0000 0.0000 253986.89 253986.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.11 82.02% 4891.16 4180 6153 4893.19 4544 5316 176628 176628 0.00
crit 7.92 17.98% 9770.07 8360 12305 9767.95 0 12305 77359 77359 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2964 (4696) 8.1% (12.8%) 91.5 3.21sec 15391 17071 Direct 92.0 8188 16370 9661 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.46 91.97 0.00 0.00 0.9016 0.0000 888543.38 888543.38 0.00 17071.49 17071.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.41 81.99% 8188.21 6967 10255 8192.86 7906 8586 617468 617468 0.00
crit 16.56 18.01% 16369.66 13933 20509 16376.51 14977 18342 271075 271075 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1732 4.7% 73.3 3.99sec 7082 0 Direct 73.3 7082 0 7082 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.30 73.30 0.00 0.00 0.0000 0.0000 519086.60 519086.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.30 100.00% 7081.71 5086 14972 7085.48 6241 8365 519087 519087 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5466.49
  • base_dd_max:5466.49
  • base_dd_mult:1.00
 
Starsurge 12445 33.9% 60.5 4.99sec 61667 58668 Direct 60.3 52481 104859 61857 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.47 60.29 0.00 0.00 1.0511 0.0000 3729090.04 3729090.04 0.00 58667.62 58667.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.49 82.10% 52481.41 45067 65508 52504.65 50790 55209 2597489 2597489 0.00
crit 10.79 17.90% 104859.15 90135 131016 104896.36 95362 118432 1131601 1131601 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1698 4.6% 12.7 23.57sec 39937 38431 Direct 12.7 2567 5132 3021 17.7%  
Periodic 218.5 1826 3650 2154 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 218.51 218.51 1.0392 1.3471 509098.49 509098.49 0.00 1655.06 38431.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 82.29% 2567.08 2231 3285 2568.11 2399 2827 26928 26928 0.00
crit 2.26 17.71% 5131.57 4546 6569 4678.01 0 6569 11587 11587 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.3 82.05% 1826.18 5 2299 1827.00 1773 1912 327416 327416 0.00
crit 39.2 17.95% 3650.08 5 4599 3651.49 3449 3972 143168 143168 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5738 15.6% 88.7 3.13sec 19281 0 Direct 88.7 16350 32700 19281 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.70 88.70 0.00 0.00 0.0000 0.0000 1710247.66 1710247.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.80 82.07% 16349.62 15985 17583 16348.91 15985 17375 1190284 1190284 0.00
crit 15.90 17.93% 32699.86 31970 35167 32698.11 31970 35167 519964 519964 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2916 8.0% 18.0 16.61sec 48691 47415 Direct 18.0 4194 8395 4948 17.9%  
Periodic 220.0 3026 6048 3569 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.95 17.95 220.01 220.01 1.0269 1.3454 874006.03 874006.03 0.00 2779.62 47415.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.73 82.06% 4193.74 3570 5255 4194.33 3873 4502 61769 61769 0.00
crit 3.22 17.94% 8395.11 7141 10511 8137.10 0 10511 27042 27042 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 82.05% 3026.44 8 3810 3027.77 2940 3175 546296 546296 0.00
crit 39.5 17.95% 6048.16 51 7620 6050.53 5689 6572 238899 238899 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.42sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.04sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9046 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.37sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1471 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.2 44.7sec 5.0sec 92.83% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.31%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.26%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.78%
  • arcanic_pulsar_6:10.35%
  • arcanic_pulsar_7:10.88%
  • arcanic_pulsar_8:14.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.21% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.11% 7.78% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.74% 32.48% 0.0(0.0) 8.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.6sec 45.7sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 94.2 0.0 154.2sec 3.2sec 99.98% 0.00% 84.5(97.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:190.14

Stack Uptimes

  • lifeblood_1:0.10%
  • lifeblood_2:0.83%
  • lifeblood_3:5.84%
  • lifeblood_4:93.22%

Trigger Attempt Success

  • trigger_pct:94.32%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 45.2 9.0sec 3.8sec 81.85% 99.69% 1.8(1.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.35%
  • lunar_empowerment_2:31.51%
  • lunar_empowerment_3:13.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.6sec 34.1sec 47.50% 0.00% 3.4(47.4) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.48%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.4 51.2 12.1sec 4.0sec 85.67% 79.83% 0.3(0.3) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.11%
  • solar_empowerment_2:39.66%
  • solar_empowerment_3:17.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.03% 92.01% 15.4(15.4) 11.5

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.87%
  • starlord_2:22.43%
  • starlord_3:59.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.6sec 23.63% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.5 2418.9 40.0 40.0 1541.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.45 739.59 (31.06%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.95 53.85 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.03 176.11 (7.40%) 4.00 0.01 0.00%
moonfire Astral Power 14.08 42.25 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.98 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.08 912.96 (38.34%) 12.00 0.06 0.01%
natures_balance Astral Power 400.63 200.31 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.39 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.22 0.00 73.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data worldvein Damage Per Second
Count 7806
Mean 36700.18
Minimum 33098.91
Maximum 41462.30
Spread ( max - min ) 8363.40
Range [ ( max - min ) / 2 * 100% ] 11.39%
Standard Deviation 1126.3951
5th Percentile 34918.59
95th Percentile 38621.71
( 95th Percentile - 5th Percentile ) 3703.11
Mean Distribution
Standard Deviation 12.7490
95.00% Confidence Intervall ( 36675.19 - 36725.17 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3619
0.1 Scale Factor Error with Delta=300 10831
0.05 Scale Factor Error with Delta=300 43324
0.01 Scale Factor Error with Delta=300 1083092
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 7806
Mean 36700.18
Minimum 33098.91
Maximum 41462.30
Spread ( max - min ) 8363.40
Range [ ( max - min ) / 2 * 100% ] 11.39%
Standard Deviation 1126.3951
5th Percentile 34918.59
95th Percentile 38621.71
( 95th Percentile - 5th Percentile ) 3703.11
Mean Distribution
Standard Deviation 12.7490
95.00% Confidence Intervall ( 36675.19 - 36725.17 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3619
0.1 Scale Factor Error with Delta=300 10831
0.05 Scale Factor Error with Delta=300 43324
0.01 Scale Factor Error with Delta=300 1083092
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 7806
Mean 36700.18
Minimum 33098.91
Maximum 41462.30
Spread ( max - min ) 8363.40
Range [ ( max - min ) / 2 * 100% ] 11.39%
Damage
Sample Data worldvein Damage
Count 7806
Mean 10990172.34
Minimum 8608248.70
Maximum 13653374.59
Spread ( max - min ) 5045125.89
Range [ ( max - min ) / 2 * 100% ] 22.95%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.47 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.78 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.47 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.05 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.77 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.54 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.31 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.45 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.71 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRKRQRNRQORQRJKPRQKQKQQQRRRKRKRKRQRLQOQKQKPQQKRNQRKQRHRORKQQRKNPQQRKRQRQRMRKKQNQKRQPKRQRQRRRRKKNOQQKRQRQKPHRQNKGRQRKRMQRKQRRKQRNPRRKQRKOQRRKQQRRKNQRRKPQRRKORQKRLQHRRRRKQIEFKPRORQKNRQRKRQRQJKRKRLQQKRPOQQRRKRQJKRKLQKRQQKRQOPRHRRRKNGQKQRRRKQRQKOQPNRRKRQKRQLQKQRQKOQRQKPQRKNQRRKQRHRORRKQKNPQKRQRQRKQRQRJKNOQQKRQRQKKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.247 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lifeblood(3), battle_potion_of_intellect
0:02.208 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
0:03.140 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
0:04.075 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
0:05.008 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
0:05.821 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
0:05.821 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect
0:05.821 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:06.577 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:07.331 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.086 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.840 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:09.692 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:10.446 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.200 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.020 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.775 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.531 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.286 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.075 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.831 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.585 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.341 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.129 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.883 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.638 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.474 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.229 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.229 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.984 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.737 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.492 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, lifeblood(3), ignition_mages_fuse(5)
0:24.347 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(24), lifeblood(3), ignition_mages_fuse(5)
0:25.101 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4), ignition_mages_fuse(5)
0:25.993 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4)
0:26.828 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4)
0:27.866 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4)
0:28.905 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4)
0:29.930 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4)
0:30.685 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4)
0:31.439 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(22), lifeblood(4)
0:32.253 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(21), lifeblood(4)
0:33.069 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4)
0:33.822 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4)
0:34.578 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4)
0:35.331 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4)
0:36.085 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4)
0:36.840 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), lifeblood(4)
0:37.759 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(4)
0:38.514 default L sunfire Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(15), lifeblood(4)
0:39.268 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(14), lifeblood(4)
0:40.335 default O moonfire Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(4)
0:41.176 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood(4)
0:42.571 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(11), lifeblood(4)
0:43.769 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), lifeblood(4)
0:45.258 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), lifeblood(4)
0:46.434 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(4)
0:47.582 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6), lifeblood(4)
0:49.049 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), lifeblood(4)
0:50.527 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(3), lifeblood(4)
0:51.690 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2), lifeblood(4)
0:52.658 default N sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, lifeblood(4)
0:53.800 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
0:55.260 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), lifeblood(4)
0:56.234 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), lifeblood(4)
0:57.376 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
0:58.835 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
0:59.809 default H worldvein_resonance Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
1:01.146 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
1:02.118 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), starlord(3), lifeblood(4), conch_of_dark_whispers
1:03.263 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lifeblood(4), conch_of_dark_whispers
1:04.512 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, lifeblood(4), conch_of_dark_whispers
1:05.760 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
1:07.305 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
1:08.850 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
1:09.881 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
1:11.093 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers
1:12.268 default P stellar_flare Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
1:13.348 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
1:14.728 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
1:16.098 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
1:17.018 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
1:18.106 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
1:18.893 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
1:20.071 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
1:20.860 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4)
1:22.224 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4)
1:23.004 default M moonfire Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4)
1:23.925 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4)
1:24.824 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power overwhelming_power(21), lifeblood(4)
1:25.980 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), lifeblood(4)
1:27.109 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), lifeblood(3)
1:28.514 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17), lifeblood(3)
1:29.621 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16), lifeblood(4)
1:31.036 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), overwhelming_power(14), lifeblood(4)
1:32.153 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), lifeblood(4)
1:33.081 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood(3)
1:34.478 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(11), lifeblood(4)
1:35.577 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4)
1:36.623 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), lifeblood(4)
1:37.518 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(3)
1:38.861 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), lifeblood(3)
1:39.760 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4)
1:41.112 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
1:42.022 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4)
1:42.932 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(18), lifeblood(4)
1:44.003 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(16), lifeblood(4)
1:45.084 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(4), overwhelming_power(15), lifeblood(4)
1:46.264 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), lifeblood(4)
1:47.416 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), lifeblood(4)
1:48.539 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), lifeblood(4)
1:49.666 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), lifeblood(4)
1:51.106 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4)
1:52.557 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(8), lifeblood(4)
1:53.702 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), lifeblood(4)
1:54.652 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood(4)
1:56.077 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4), lifeblood(4)
1:57.033 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), lifeblood(4)
1:58.477 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood(4)
1:59.615 default P stellar_flare Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power, lifeblood(4)
2:00.757 default H worldvein_resonance Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
2:01.903 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
2:02.876 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
2:04.335 default N sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4)
2:05.482 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), lifeblood(4)
2:06.730 default G use_items Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4)
2:06.730 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4), ignition_mages_fuse
2:07.590 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), ignition_mages_fuse
2:08.879 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, solar_empowerment(3), starlord, lifeblood(4), ignition_mages_fuse
2:09.738 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment(2), starlord, lifeblood(4), ignition_mages_fuse
2:10.750 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(4), ignition_mages_fuse(2)
2:11.554 default M moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(2)
2:12.499 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(2)
2:13.882 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(2)
2:14.805 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(2), lifeblood(4), ignition_mages_fuse(3)
2:15.851 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(3)
2:17.145 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(3)
2:18.009 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(3)
2:18.873 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), starlord(3), lifeblood(4), ignition_mages_fuse(4)
2:19.852 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
2:21.099 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(4)
2:21.931 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
2:22.912 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(5)
2:23.857 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4), ignition_mages_fuse(5)
2:24.611 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(24), lifeblood(4), ignition_mages_fuse(5)
2:25.491 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), overwhelming_power(23), lifeblood(4), ignition_mages_fuse(5)
2:26.451 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), lifeblood(4), ignition_mages_fuse(5)
2:27.642 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(21), lifeblood(4)
2:28.597 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), starlord, overwhelming_power(20), lifeblood(4)
2:29.725 default O moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(19), lifeblood(4)
2:30.824 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(18), lifeblood(4)
2:32.228 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(16), lifeblood(4)
2:33.173 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), starlord(2), overwhelming_power(15), lifeblood(4)
2:34.288 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(2), overwhelming_power(14), lifeblood(4)
2:35.406 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4)
2:36.798 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), lifeblood(4)
2:38.194 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(10), lifeblood(4)
2:39.133 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(9), lifeblood(4)
2:40.241 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(8), lifeblood(4)
2:41.353 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), lifeblood(4)
2:42.471 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), lifeblood(4)
2:43.897 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(5), lifeblood(4)
2:44.854 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(4), lifeblood(4)
2:45.982 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), overwhelming_power(3), lifeblood(4)
2:47.218 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power, lifeblood(4)
2:48.424 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
2:49.969 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:51.000 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:52.212 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:53.422 default O moonfire Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:54.445 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:55.318 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:56.626 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power celestial_alignment, starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:57.650 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:58.499 default L sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
2:59.496 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:00.955 default H worldvein_resonance Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:02.101 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:03.249 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord(3), lifeblood(4), conch_of_dark_whispers
3:04.394 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord(3), lifeblood(4), conch_of_dark_whispers
3:05.539 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, starlord(3), lifeblood(4)
3:06.684 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar, lunar_empowerment, lifeblood(4)
3:07.933 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4)
3:09.477 default I celestial_alignment Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
3:10.532 default E potion Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
3:10.532 default F berserking Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect
3:10.532 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect
3:11.491 default P stellar_flare Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4), battle_potion_of_intellect
3:12.423 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4), battle_potion_of_intellect
3:13.215 default O moonfire Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect
3:14.148 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect
3:14.941 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect
3:16.131 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect
3:17.064 default N sunfire Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:17.970 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:18.742 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:19.896 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(3), battle_potion_of_intellect
3:20.651 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect
3:21.480 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:22.235 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect
3:23.300 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:24.085 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:25.265 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:25.265 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:26.277 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(18), lifeblood(4), battle_potion_of_intellect
3:27.117 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), lifeblood(4), battle_potion_of_intellect
3:28.108 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect
3:28.908 default L sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect
3:29.848 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:31.228 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:32.621 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:33.717 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:34.624 default P stellar_flare Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4), battle_potion_of_intellect
3:35.698 default O moonfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
3:36.776 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(4)
3:38.150 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4)
3:39.537 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(4)
3:40.465 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12), lifeblood(4)
3:41.397 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11), lifeblood(4)
3:42.497 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), lifeblood(4)
3:43.315 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(9), lifeblood(4)
3:44.544 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, starlord(3), overwhelming_power(8), lifeblood(4)
3:44.544 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, overwhelming_power(8), lifeblood(4)
3:45.598 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), lifeblood(4)
3:46.417 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(24), lifeblood(4)
3:47.384 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4)
3:48.328 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), lifeblood(4)
3:49.714 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(4)
3:50.806 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), lifeblood(3)
3:51.712 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
3:53.074 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
3:54.443 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(4)
3:55.525 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), lifeblood(4)
3:56.448 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4)
3:57.834 default O moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(4)
3:58.927 default P stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood(4)
4:00.023 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4)
4:00.963 default H worldvein_resonance Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(10), lifeblood(4)
4:02.066 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(8), lifeblood(4)
4:03.012 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(7), lifeblood(4)
4:04.127 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(6), lifeblood(4)
4:05.248 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), overwhelming_power(5), lifeblood(4)
4:06.475 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), lifeblood(4)
4:07.668 default G use_items Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3), lifeblood(4)
4:07.668 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3), lifeblood(4), ignition_mages_fuse
4:09.134 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power, lifeblood(4), ignition_mages_fuse
4:10.293 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse
4:11.731 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(2)
4:12.655 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), lifeblood(4), ignition_mages_fuse(2)
4:13.578 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), starlord(2), lifeblood(4), ignition_mages_fuse(2)
4:14.665 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(2), lifeblood(4), ignition_mages_fuse(2)
4:15.750 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:17.046 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:17.909 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:19.204 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:20.220 default O moonfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:21.200 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:22.448 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:23.427 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:24.408 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4), ignition_mages_fuse(5)
4:25.212 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4), ignition_mages_fuse(5)
4:26.157 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, lifeblood(4), ignition_mages_fuse(5)
4:27.189 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), ignition_mages_fuse(5)
4:27.944 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), starlord, lifeblood(4)
4:29.288 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment, starlord, lifeblood(4)
4:30.343 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
4:31.215 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
4:32.520 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
4:33.545 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
4:35.047 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, lifeblood(4)
4:36.224 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
4:37.685 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:38.657 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:40.115 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:41.259 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:42.404 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:43.862 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:44.836 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:46.295 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, lifeblood(4), conch_of_dark_whispers
4:47.543 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
4:48.756 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
4:50.301 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
4:51.331 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
4:52.543 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
4:53.722 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
4:55.223 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), lifeblood(4)
4:56.224 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), lifeblood(3)
4:57.225 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), starlord(2), lifeblood(3)
4:58.403 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4)
4:59.861 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(4)
5:00.834 default H worldvein_resonance Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(4)
5:02.107 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(4)
5:03.080 default O moonfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), starlord(3), lifeblood(4)
5:04.225 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), starlord(3), lifeblood(4)
5:05.372 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(6), starlord(3), lifeblood(4)
5:06.517 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), lunar_empowerment, lifeblood(4)
5:07.766 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4)
5:09.311 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
5:10.523 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
5:11.700 default P stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
5:12.877 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
5:14.376 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4)
5:15.458 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), lifeblood(4)
5:16.239 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4)
5:17.410 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4)
5:18.196 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4)
5:19.377 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
5:20.168 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4)
5:21.100 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
5:22.470 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16), lifeblood(4)
5:23.388 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4)
5:24.767 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4)
5:25.691 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4)
5:25.691 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, overwhelming_power(13), lifeblood(4)
5:26.882 default N sunfire Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(12), lifeblood(4)
5:28.040 default O moonfire Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(24), lifeblood(4)
5:29.153 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(23), lifeblood(4)
5:30.573 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(22), lifeblood(4)
5:31.997 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(21), lifeblood(4)
5:33.121 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(19), lifeblood(3)
5:34.056 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), lifeblood(3)
5:35.460 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(17), lifeblood(4)
5:36.401 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), lifeblood(4)
5:37.815 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), lifeblood(4)
5:38.930 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), lifeblood(4)
5:40.019 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(12), lifeblood(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

Simulation & Raid Information

Iterations: 7812
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.1 )

Performance:

Total Events Processed: 239575866
Max Event Queue: 425
Sim Seconds: 2344405
CPU Seconds: 468.0781
Physical Seconds: 97.2877
Speed Up: 5009

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 300.10sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 300.10sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
base base heed_my_call 271685 88017 293 1.64 9104 18209 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.14sec 88017 300.10sec
base base heed_my_call_aoe 271686 37753 126 1.64 3902 7805 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.14sec 37753 300.10sec
base base lunar_strike 194153 1519514 5063 15.54 16570 33124 77.7 77.7 18.0% 0.0% 0.0% 0.0% 3.78sec 1519514 300.10sec
base base moonfire 8921 47400 158 2.81 2860 5719 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.40sec 735995 300.10sec
base base moonfire ticks -8921 688595 2295 44.39 2630 5254 14.1 221.9 18.0% 0.0% 0.0% 0.0% 21.40sec 735995 300.10sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
base base shooting_stars 202497 238097 793 8.85 4565 9113 44.3 44.3 17.9% 0.0% 0.0% 0.0% 6.62sec 238097 300.10sec
base base solar_wrath 190984 854623 2848 18.99 7633 15255 94.5 95.0 17.9% 0.0% 0.0% 0.0% 3.12sec 854623 300.10sec
base base solar_empowerment 279729 493619 1645 14.96 6595 0 74.8 74.8 0.0% 0.0% 0.0% 0.0% 3.93sec 493619 300.10sec
base base starsurge 78674 3566879 11886 12.29 49245 98356 61.6 61.4 17.9% 0.0% 0.0% 0.0% 4.92sec 3566879 300.10sec
base base stellar_flare 202347 36571 122 2.56 2423 4845 12.8 12.8 17.9% 0.0% 0.0% 0.0% 23.58sec 478031 300.10sec
base base stellar_flare ticks -202347 441460 1472 43.92 1704 3406 12.8 219.6 18.0% 0.0% 0.0% 0.0% 23.58sec 478031 300.10sec
base base streaking_stars 272873 1734568 5780 18.01 16348 32706 90.1 90.1 17.8% 0.0% 0.0% 0.0% 3.10sec 1734568 300.10sec
base base sunfire 93402 82563 275 3.57 3912 7830 17.9 17.9 18.1% 0.0% 0.0% 0.0% 16.78sec 818719 300.10sec
base base sunfire ticks -93402 736156 2454 44.22 2825 5644 17.9 221.1 17.9% 0.0% 0.0% 0.0% 16.78sec 818719 300.10sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.50sec 0 300.10sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 108444 361 0.74 22903 57261 3.7 3.7 19.0% 0.0% 0.0% 0.0% 91.17sec 108444 300.10sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.67sec 0 300.10sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
blood of the enemy blood of the enemy heed_my_call 271685 92815 309 1.65 9108 18717 8.2 8.2 22.4% 0.0% 0.0% 0.0% 32.88sec 92815 300.10sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 39832 133 1.65 3904 8022 8.2 8.2 22.5% 0.0% 0.0% 0.0% 32.88sec 39832 300.10sec
blood of the enemy blood of the enemy lunar_strike 194153 1565973 5218 15.45 16498 33932 77.3 77.3 21.6% 0.0% 0.0% 0.0% 3.79sec 1565973 300.10sec
blood of the enemy blood of the enemy moonfire 8921 49494 165 2.81 2848 5913 14.1 14.1 21.8% 0.0% 0.0% 0.0% 21.39sec 780420 300.10sec
blood of the enemy blood of the enemy moonfire ticks -8921 730926 2436 44.80 2616 5510 14.1 224.0 22.4% 0.0% 0.0% 0.0% 21.39sec 780420 300.10sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
blood of the enemy blood of the enemy shooting_stars 202497 252669 842 8.94 4540 9541 44.7 44.7 22.2% 0.0% 0.0% 0.0% 6.58sec 252669 300.10sec
blood of the enemy blood of the enemy solar_wrath 190984 887049 2956 18.87 7588 15696 93.9 94.4 22.3% 0.0% 0.0% 0.0% 3.13sec 887049 300.10sec
blood of the enemy blood of the enemy solar_empowerment 279729 516227 1720 14.90 6929 0 74.5 74.5 0.0% 0.0% 0.0% 0.0% 3.93sec 516227 300.10sec
blood of the enemy blood of the enemy starsurge 78674 3761571 12534 12.24 48964 103637 61.4 61.2 22.8% 0.0% 0.0% 0.0% 4.92sec 3761571 300.10sec
blood of the enemy blood of the enemy stellar_flare 202347 38405 128 2.56 2408 5128 12.8 12.8 21.8% 0.0% 0.0% 0.0% 23.58sec 507461 300.10sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 469056 1564 44.33 1696 3573 12.8 221.7 22.4% 0.0% 0.0% 0.0% 23.58sec 507461 300.10sec
blood of the enemy blood of the enemy streaking_stars 272873 1862936 6208 17.73 16356 34099 88.7 88.7 26.2% 0.0% 0.0% 0.0% 3.14sec 1862936 300.10sec
blood of the enemy blood of the enemy sunfire 93402 85424 285 3.57 3901 8026 17.9 17.9 21.4% 0.0% 0.0% 0.0% 16.74sec 866528 300.10sec
blood of the enemy blood of the enemy sunfire ticks -93402 781103 2604 44.63 2811 5905 17.9 223.2 22.3% 0.0% 0.0% 0.0% 16.74sec 866528 300.10sec
conflict+strife conflict+strife augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
conflict+strife conflict+strife berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.67sec 0 300.10sec
conflict+strife conflict+strife celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.60sec 0 300.10sec
conflict+strife conflict+strife flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
conflict+strife conflict+strife food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
conflict+strife conflict+strife heed_my_call 271685 91179 304 1.64 9452 18909 8.2 8.2 17.9% 0.0% 0.0% 0.0% 32.98sec 91179 300.10sec
conflict+strife conflict+strife heed_my_call_aoe 271686 39097 130 1.64 4051 8102 8.2 8.2 17.9% 0.0% 0.0% 0.0% 32.98sec 39097 300.10sec
conflict+strife conflict+strife lunar_strike 194153 1577492 5257 15.55 17208 34381 77.8 77.8 17.9% 0.0% 0.0% 0.0% 3.77sec 1577492 300.10sec
conflict+strife conflict+strife moonfire 8921 49188 164 2.81 2965 5933 14.1 14.1 17.9% 0.0% 0.0% 0.0% 21.41sec 763124 300.10sec
conflict+strife conflict+strife moonfire ticks -8921 713936 2380 44.39 2728 5452 14.1 222.0 17.9% 0.0% 0.0% 0.0% 21.41sec 763124 300.10sec
conflict+strife conflict+strife moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
conflict+strife conflict+strife potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
conflict+strife conflict+strife shooting_stars 202497 246805 822 8.84 4734 9461 44.2 44.2 17.9% 0.0% 0.0% 0.0% 6.59sec 246805 300.10sec
conflict+strife conflict+strife solar_wrath 190984 886452 2954 18.99 7918 15829 94.5 95.0 17.9% 0.0% 0.0% 0.0% 3.12sec 886452 300.10sec
conflict+strife conflict+strife solar_empowerment 279729 512444 1708 14.97 6842 0 74.9 74.9 0.0% 0.0% 0.0% 0.0% 3.93sec 512444 300.10sec
conflict+strife conflict+strife starsurge 78674 3701798 12335 12.29 51069 102100 61.6 61.4 18.0% 0.0% 0.0% 0.0% 4.92sec 3701798 300.10sec
conflict+strife conflict+strife stellar_flare 202347 37864 126 2.56 2513 5029 12.8 12.8 17.7% 0.0% 0.0% 0.0% 23.58sec 495639 300.10sec
conflict+strife conflict+strife stellar_flare ticks -202347 457775 1526 43.92 1768 3535 12.8 219.6 17.9% 0.0% 0.0% 0.0% 23.58sec 495639 300.10sec
conflict+strife conflict+strife streaking_stars 272873 1792163 5972 18.00 16895 33798 90.0 90.0 17.8% 0.0% 0.0% 0.0% 3.11sec 1792163 300.10sec
conflict+strife conflict+strife sunfire 93402 85362 284 3.57 4058 8118 17.9 17.9 17.8% 0.0% 0.0% 0.0% 16.78sec 849356 300.10sec
conflict+strife conflict+strife sunfire ticks -93402 763993 2547 44.22 2930 5857 17.9 221.1 17.9% 0.0% 0.0% 0.0% 16.78sec 849356 300.10sec
crucible of flame crucible of flame ancient_flame ticks -295367 375654 1252 17.97 3544 7092 24.9 89.9 18.0% 0.0% 0.0% 0.0% 11.78sec 375654 300.10sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.50sec 0 300.10sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.42sec 0 300.10sec
crucible of flame crucible of flame concentrated_flame 295373 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 29.91sec 0 300.10sec
crucible of flame crucible of flame concentrated_flame_missile 295374 340497 1135 2.30 25150 50760 11.5 11.5 17.6% 0.0% 0.0% 0.0% 29.91sec 340497 300.10sec
crucible of flame crucible of flame concentrated_flame_burn ticks -295368 222207 741 6.41 6928 0 11.5 32.1 0.0% 0.0% 0.0% 0.0% 29.91sec 222207 300.10sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
crucible of flame crucible of flame heed_my_call 271685 87598 292 1.63 9109 18228 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.10sec 87598 300.10sec
crucible of flame crucible of flame heed_my_call_aoe 271686 37521 125 1.63 3904 7809 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.10sec 37521 300.10sec
crucible of flame crucible of flame lunar_strike 194153 1452821 4841 14.84 16598 33199 74.2 74.2 17.9% 0.0% 0.0% 0.0% 3.93sec 1452821 300.10sec
crucible of flame crucible of flame moonfire 8921 47220 157 2.81 2848 5695 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.27sec 727983 300.10sec
crucible of flame crucible of flame moonfire ticks -8921 680763 2269 43.98 2625 5249 14.1 219.9 17.9% 0.0% 0.0% 0.0% 21.27sec 727983 300.10sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
crucible of flame crucible of flame shooting_stars 202497 236073 787 8.78 4557 9109 43.9 43.9 18.0% 0.0% 0.0% 0.0% 6.60sec 236073 300.10sec
crucible of flame crucible of flame solar_wrath 190984 804773 2682 17.85 7645 15278 88.7 89.3 17.9% 0.0% 0.0% 0.0% 3.31sec 804773 300.10sec
crucible of flame crucible of flame solar_empowerment 279729 473096 1576 14.34 6598 0 71.7 71.7 0.0% 0.0% 0.0% 0.0% 4.07sec 473096 300.10sec
crucible of flame crucible of flame starsurge 78674 3432692 11438 11.82 49258 98364 59.3 59.1 18.0% 0.0% 0.0% 0.0% 5.07sec 3432692 300.10sec
crucible of flame crucible of flame stellar_flare 202347 35546 118 2.54 2369 4733 12.7 12.7 18.1% 0.0% 0.0% 0.0% 23.58sec 472195 300.10sec
crucible of flame crucible of flame stellar_flare ticks -202347 436650 1455 43.51 1702 3403 12.7 217.6 17.9% 0.0% 0.0% 0.0% 23.58sec 472195 300.10sec
crucible of flame crucible of flame streaking_stars 272873 1653491 5510 17.14 16354 32709 85.8 85.8 17.9% 0.0% 0.0% 0.0% 3.23sec 1653491 300.10sec
crucible of flame crucible of flame sunfire 93402 81598 272 3.54 3905 7806 17.7 17.7 18.0% 0.0% 0.0% 0.0% 16.78sec 810289 300.10sec
crucible of flame crucible of flame sunfire ticks -93402 728691 2429 43.82 2821 5637 17.7 219.1 17.9% 0.0% 0.0% 0.0% 16.78sec 810289 300.10sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.64sec 0 300.10sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.45sec 0 300.10sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
focusing iris focusing iris heed_my_call 271685 91386 305 1.70 9109 18212 8.5 8.5 17.9% 0.0% 0.0% 0.0% 32.22sec 91386 300.10sec
focusing iris focusing iris heed_my_call_aoe 271686 39110 130 1.70 3904 7806 8.5 8.5 17.7% 0.0% 0.0% 0.0% 32.22sec 39110 300.10sec
focusing iris focusing iris lunar_strike 194153 1580626 5267 16.16 16587 33164 80.8 80.8 17.9% 0.0% 0.0% 0.0% 3.64sec 1580626 300.10sec
focusing iris focusing iris moonfire 8921 47622 159 2.83 2854 5701 14.2 14.2 17.8% 0.0% 0.0% 0.0% 21.36sec 764451 300.10sec
focusing iris focusing iris moonfire ticks -8921 716829 2389 46.20 2632 5261 14.2 231.0 17.9% 0.0% 0.0% 0.0% 21.36sec 764451 300.10sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
focusing iris focusing iris shooting_stars 202497 248063 827 9.20 4566 9123 46.0 46.0 18.1% 0.0% 0.0% 0.0% 6.36sec 248063 300.10sec
focusing iris focusing iris solar_wrath 190984 902167 3006 20.02 7641 15272 99.6 100.1 18.0% 0.0% 0.0% 0.0% 2.96sec 902167 300.10sec
focusing iris focusing iris solar_empowerment 279729 513112 1710 15.53 6606 0 77.7 77.7 0.0% 0.0% 0.0% 0.0% 3.78sec 513112 300.10sec
focusing iris focusing iris starsurge 78674 3697064 12319 12.72 49279 98470 63.8 63.6 17.9% 0.0% 0.0% 0.0% 4.75sec 3697064 300.10sec
focusing iris focusing iris stellar_flare 202347 36666 122 2.56 2428 4861 12.8 12.8 17.9% 0.0% 0.0% 0.0% 23.57sec 496650 300.10sec
focusing iris focusing iris stellar_flare ticks -202347 459984 1533 45.73 1706 3409 12.8 228.6 18.0% 0.0% 0.0% 0.0% 23.57sec 496650 300.10sec
focusing iris focusing iris streaking_stars 272873 1804339 6012 18.72 16350 32708 93.6 93.6 17.9% 0.0% 0.0% 0.0% 3.02sec 1804339 300.10sec
focusing iris focusing iris sunfire 93402 81065 270 3.51 3912 7827 17.6 17.6 18.0% 0.0% 0.0% 0.0% 17.07sec 848421 300.10sec
focusing iris focusing iris sunfire ticks -93402 767356 2558 46.04 2827 5651 17.6 230.2 17.9% 0.0% 0.0% 0.0% 17.07sec 848421 300.10sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
life-force life-force azerite_spike 295835 222276 741 3.38 11153 22300 16.9 16.9 18.0% 0.0% 0.0% 0.0% 17.05sec 222276 300.10sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 300.10sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.45sec 0 300.10sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
life-force life-force guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
life-force life-force heed_my_call 271685 91838 306 1.67 9325 18637 8.3 8.3 18.1% 0.0% 0.0% 0.0% 32.81sec 91838 300.10sec
life-force life-force heed_my_call_aoe 271686 39295 131 1.67 3996 7993 8.3 8.3 17.9% 0.0% 0.0% 0.0% 32.81sec 39295 300.10sec
life-force life-force lunar_strike 194153 1563734 5211 15.60 16990 33965 78.0 78.0 18.0% 0.0% 0.0% 0.0% 3.75sec 1563734 300.10sec
life-force life-force moonfire 8921 48362 161 2.81 2918 5838 14.0 14.0 18.0% 0.0% 0.0% 0.0% 21.39sec 769958 300.10sec
life-force life-force moonfire ticks -8921 721595 2405 45.22 2705 5407 14.0 226.1 18.0% 0.0% 0.0% 0.0% 21.39sec 769958 300.10sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
life-force life-force shooting_stars 202497 249140 830 8.99 4693 9376 45.0 45.0 18.0% 0.0% 0.0% 0.0% 6.48sec 249140 300.10sec
life-force life-force solar_wrath 190984 884216 2946 19.10 7851 15682 95.0 95.5 17.9% 0.0% 0.0% 0.0% 3.10sec 884216 300.10sec
life-force life-force solar_empowerment 279729 509570 1698 15.03 6778 0 75.2 75.2 0.0% 0.0% 0.0% 0.0% 3.89sec 509570 300.10sec
life-force life-force starsurge 78674 3677971 12256 12.34 50523 101000 61.9 61.7 18.0% 0.0% 0.0% 0.0% 4.87sec 3677971 300.10sec
life-force life-force stellar_flare 202347 37347 124 2.55 2486 4967 12.8 12.8 17.8% 0.0% 0.0% 0.0% 23.57sec 499406 300.10sec
life-force life-force stellar_flare ticks -202347 462058 1540 44.74 1752 3502 12.8 223.7 17.9% 0.0% 0.0% 0.0% 23.57sec 499406 300.10sec
life-force life-force streaking_stars 272873 1849649 6163 18.50 16951 33901 92.5 92.5 18.0% 0.0% 0.0% 0.0% 3.01sec 1849649 300.10sec
life-force life-force sunfire 93402 85348 284 3.59 4022 8048 18.0 18.0 18.1% 0.0% 0.0% 0.0% 16.64sec 857609 300.10sec
life-force life-force sunfire ticks -93402 772261 2574 45.05 2905 5806 18.0 225.2 18.0% 0.0% 0.0% 0.0% 16.64sec 857609 300.10sec
life-force life-force_guardian_of_azeroth azerite_spike 295856 474086 7901 58.20 6927 13853 58.2 58.2 17.6% 0.0% 0.0% 0.0% 3.64sec 474086 60.00sec
life-force life-force_guardian_of_azeroth azerite_volley 303351 61134 1019 6.00 8658 17316 6.0 6.0 17.7% 0.0% 0.0% 0.0% 39.27sec 61134 60.00sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.01sec 0 300.10sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.03sec 0 300.10sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
lucid dreams lucid dreams heed_my_call 271685 89300 298 1.65 9199 18409 8.2 8.2 17.9% 0.0% 0.0% 0.0% 32.75sec 89300 300.10sec
lucid dreams lucid dreams heed_my_call_aoe 271686 38305 128 1.65 3943 7886 8.2 8.2 18.0% 0.0% 0.0% 0.0% 32.75sec 38305 300.10sec
lucid dreams lucid dreams lunar_strike 194153 1508393 5026 15.26 16747 33490 76.3 76.3 18.0% 0.0% 0.0% 0.0% 3.83sec 1508393 300.10sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.00sec 0 300.10sec
lucid dreams lucid dreams moonfire 8921 47860 159 2.84 2860 5715 14.2 14.2 18.0% 0.0% 0.0% 0.0% 21.25sec 747516 300.10sec
lucid dreams lucid dreams moonfire ticks -8921 699655 2332 44.51 2667 5329 14.2 222.5 17.9% 0.0% 0.0% 0.0% 21.25sec 747516 300.10sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
lucid dreams lucid dreams shooting_stars 202497 242026 806 8.87 4627 9251 44.4 44.4 17.9% 0.0% 0.0% 0.0% 6.61sec 242026 300.10sec
lucid dreams lucid dreams solar_wrath 190984 776079 2586 16.97 7757 15512 84.2 84.9 17.9% 0.0% 0.0% 0.0% 3.48sec 776079 300.10sec
lucid dreams lucid dreams solar_empowerment 279729 537240 1790 16.04 6696 0 80.2 80.2 0.0% 0.0% 0.0% 0.0% 3.64sec 537240 300.10sec
lucid dreams lucid dreams starsurge 78674 4235387 14113 14.38 49991 99859 72.2 71.9 17.9% 0.0% 0.0% 0.0% 4.21sec 4235387 300.10sec
lucid dreams lucid dreams stellar_flare 202347 36848 123 2.56 2446 4893 12.8 12.8 17.8% 0.0% 0.0% 0.0% 23.58sec 486342 300.10sec
lucid dreams lucid dreams stellar_flare ticks -202347 449495 1498 44.06 1729 3455 12.8 220.3 18.0% 0.0% 0.0% 0.0% 23.58sec 486342 300.10sec
lucid dreams lucid dreams streaking_stars 272873 1890875 6301 19.36 16563 33125 96.8 96.8 17.9% 0.0% 0.0% 0.0% 2.91sec 1890875 300.10sec
lucid dreams lucid dreams sunfire 93402 81613 272 3.49 3970 7943 17.5 17.5 17.8% 0.0% 0.0% 0.0% 17.14sec 829598 300.10sec
lucid dreams lucid dreams sunfire ticks -93402 747985 2493 44.34 2863 5723 17.5 221.7 17.9% 0.0% 0.0% 0.0% 17.14sec 829598 300.10sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.47sec 0 300.10sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.19sec 0 300.10sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
purification protocol purification protocol heed_my_call 271685 87613 292 1.63 9108 18219 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.41sec 87613 300.10sec
purification protocol purification protocol heed_my_call_aoe 271686 37485 125 1.63 3904 7805 8.2 8.2 17.8% 0.0% 0.0% 0.0% 33.41sec 37485 300.10sec
purification protocol purification protocol lunar_strike 194153 1491518 4970 15.23 16594 33182 76.2 76.2 18.0% 0.0% 0.0% 0.0% 3.84sec 1491518 300.10sec
purification protocol purification protocol moonfire 8921 47341 158 2.82 2855 5705 14.1 14.1 17.7% 0.0% 0.0% 0.0% 21.32sec 731991 300.10sec
purification protocol purification protocol moonfire ticks -8921 684650 2282 44.17 2628 5253 14.1 220.9 18.0% 0.0% 0.0% 0.0% 21.32sec 731991 300.10sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
purification protocol purification protocol purification_protocol 295293 181433 605 3.31 9295 18592 16.5 16.5 18.0% 0.0% 0.0% 0.0% 17.45sec 181433 300.10sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 300.10sec
purification protocol purification protocol purifying_tick ticks -295338 202439 675 0.00 4533 9069 38.0 0.0 17.6% 0.0% 0.0% 0.0% 7.63sec 202439 300.10sec
purification protocol purification protocol shooting_stars 202497 237496 791 8.83 4560 9109 44.2 44.2 18.0% 0.0% 0.0% 0.0% 6.62sec 237496 300.10sec
purification protocol purification protocol solar_wrath 190984 828494 2761 18.37 7643 15273 91.4 91.9 18.0% 0.0% 0.0% 0.0% 3.22sec 828494 300.10sec
purification protocol purification protocol solar_empowerment 279729 484526 1615 14.68 6600 0 73.4 73.4 0.0% 0.0% 0.0% 0.0% 3.98sec 484526 300.10sec
purification protocol purification protocol starsurge 78674 3502673 11672 12.06 49257 98412 60.5 60.3 17.9% 0.0% 0.0% 0.0% 4.99sec 3502673 300.10sec
purification protocol purification protocol stellar_flare 202347 36056 120 2.55 2397 4788 12.8 12.8 18.0% 0.0% 0.0% 0.0% 23.58sec 474821 300.10sec
purification protocol purification protocol stellar_flare ticks -202347 438765 1463 43.70 1703 3404 12.8 218.5 17.9% 0.0% 0.0% 0.0% 23.58sec 474821 300.10sec
purification protocol purification protocol streaking_stars 272873 1710741 5701 17.74 16352 32703 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.13sec 1710741 300.10sec
purification protocol purification protocol sunfire 93402 82927 276 3.59 3913 7825 17.9 17.9 18.1% 0.0% 0.0% 0.0% 16.63sec 814980 300.10sec
purification protocol purification protocol sunfire ticks -93402 732053 2440 44.00 2823 5640 17.9 220.0 17.9% 0.0% 0.0% 0.0% 16.63sec 814980 300.10sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.44sec 0 300.10sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.08sec 0 300.10sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
ripple in space ripple in space heed_my_call 271685 87480 291 1.63 9110 18226 8.1 8.1 18.0% 0.0% 0.0% 0.0% 33.69sec 87480 300.10sec
ripple in space ripple in space heed_my_call_aoe 271686 37616 125 1.63 3904 7810 8.1 8.1 18.4% 0.0% 0.0% 0.0% 33.69sec 37616 300.10sec
ripple in space ripple in space lunar_strike 194153 1551283 5169 15.21 17279 34535 76.1 76.1 18.1% 0.0% 0.0% 0.0% 3.84sec 1551283 300.10sec
ripple in space ripple in space moonfire 8921 49547 165 2.81 2981 5963 14.1 14.1 18.0% 0.0% 0.0% 0.0% 21.32sec 762851 300.10sec
ripple in space ripple in space moonfire ticks -8921 713303 2378 44.17 2738 5472 14.1 220.9 18.0% 0.0% 0.0% 0.0% 21.32sec 762851 300.10sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
ripple in space ripple in space ripple_in_space 302731 104074 347 1.09 19117 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.37sec 104074 300.10sec
ripple in space ripple in space shooting_stars 202497 247068 823 8.82 4749 9492 44.1 44.1 17.9% 0.0% 0.0% 0.0% 6.62sec 247068 300.10sec
ripple in space ripple in space solar_wrath 190984 863665 2878 18.40 7963 15908 91.5 92.0 17.9% 0.0% 0.0% 0.0% 3.22sec 863665 300.10sec
ripple in space ripple in space solar_empowerment 279729 503635 1678 14.66 6870 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 4.00sec 503635 300.10sec
ripple in space ripple in space starsurge 78674 3631708 12102 12.05 51107 102120 60.5 60.3 17.9% 0.0% 0.0% 0.0% 4.99sec 3631708 300.10sec
ripple in space ripple in space stellar_flare 202347 37423 125 2.55 2492 4980 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.57sec 494738 300.10sec
ripple in space ripple in space stellar_flare ticks -202347 457315 1524 43.71 1774 3546 12.7 218.5 18.0% 0.0% 0.0% 0.0% 23.57sec 494738 300.10sec
ripple in space ripple in space streaking_stars 272873 1709938 5698 17.74 16356 32708 88.7 88.7 17.8% 0.0% 0.0% 0.0% 3.13sec 1709938 300.10sec
ripple in space ripple in space sunfire 93402 86403 288 3.59 4079 8155 18.0 18.0 18.0% 0.0% 0.0% 0.0% 16.63sec 848994 300.10sec
ripple in space ripple in space sunfire ticks -93402 762591 2542 44.00 2940 5875 18.0 220.0 17.9% 0.0% 0.0% 0.0% 16.63sec 848994 300.10sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.40sec 0 300.10sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.10sec 0 300.10sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
unbound force unbound force heed_my_call 271685 90226 301 1.62 9107 18218 8.1 8.1 22.0% 0.0% 0.0% 0.0% 33.82sec 90226 300.10sec
unbound force unbound force heed_my_call_aoe 271686 38656 129 1.62 3903 7809 8.1 8.1 22.0% 0.0% 0.0% 0.0% 33.82sec 38656 300.10sec
unbound force unbound force lunar_strike 194153 1521059 5068 15.24 16586 33088 76.2 76.2 20.4% 0.0% 0.0% 0.0% 3.84sec 1521059 300.10sec
unbound force unbound force moonfire 8921 48743 162 2.81 2856 5693 14.1 14.1 21.4% 0.0% 0.0% 0.0% 21.33sec 753850 300.10sec
unbound force unbound force moonfire ticks -8921 705107 2350 44.18 2630 5239 14.1 220.9 21.5% 0.0% 0.0% 0.0% 21.33sec 753850 300.10sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
unbound force unbound force shooting_stars 202497 244831 816 8.82 4562 9094 44.1 44.1 21.8% 0.0% 0.0% 0.0% 6.64sec 244831 300.10sec
unbound force unbound force solar_wrath 190984 848657 2828 18.47 7638 15254 91.8 92.4 20.4% 0.0% 0.0% 0.0% 3.20sec 848657 300.10sec
unbound force unbound force solar_empowerment 279729 494914 1649 14.69 6735 0 73.5 73.5 0.0% 0.0% 0.0% 0.0% 3.99sec 494914 300.10sec
unbound force unbound force starsurge 78674 3595312 11980 12.08 49269 98169 60.6 60.4 20.9% 0.0% 0.0% 0.0% 4.98sec 3595312 300.10sec
unbound force unbound force stellar_flare 202347 37024 123 2.55 2400 4786 12.8 12.8 21.1% 0.0% 0.0% 0.0% 23.58sec 488954 300.10sec
unbound force unbound force stellar_flare ticks -202347 451930 1506 43.72 1704 3396 12.8 218.6 21.5% 0.0% 0.0% 0.0% 23.58sec 488954 300.10sec
unbound force unbound force streaking_stars 272873 1732501 5773 17.65 16347 32700 88.3 88.3 20.1% 0.0% 0.0% 0.0% 3.15sec 1732501 300.10sec
unbound force unbound force sunfire 93402 85637 285 3.60 3916 7812 18.0 18.0 21.7% 0.0% 0.0% 0.0% 16.59sec 839377 300.10sec
unbound force unbound force sunfire ticks -93402 753740 2512 44.01 2824 5628 18.0 220.1 21.4% 0.0% 0.0% 0.0% 16.59sec 839377 300.10sec
unbound force unbound force the_unbound_force ticks -298452 334322 1114 7.93 1322 6798 5.0 39.6 76.5% 0.0% 0.0% 0.0% 67.20sec 334322 300.10sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.44sec 0 300.10sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 154.57sec 0 300.10sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
visions visions heed_my_call 271685 90629 302 1.67 9193 18378 8.3 8.3 18.1% 0.0% 0.0% 0.0% 32.88sec 90629 300.10sec
visions visions heed_my_call_aoe 271686 38771 129 1.67 3940 7878 8.3 8.3 17.9% 0.0% 0.0% 0.0% 32.88sec 38771 300.10sec
visions visions lunar_strike 194153 1585092 5282 15.79 17001 33991 79.0 79.0 18.0% 0.0% 0.0% 0.0% 3.72sec 1585092 300.10sec
visions visions moonfire 8921 48808 163 2.85 2906 5810 14.3 14.3 17.7% 0.0% 0.0% 0.0% 21.19sec 769264 300.10sec
visions visions moonfire ticks -8921 720456 2402 45.16 2705 5408 14.3 225.8 18.0% 0.0% 0.0% 0.0% 21.19sec 769264 300.10sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
visions visions shooting_stars 202497 249305 831 9.00 4694 9385 45.0 45.0 18.0% 0.0% 0.0% 0.0% 6.53sec 249305 300.10sec
visions visions solar_wrath 190984 883728 2945 19.01 7883 15761 94.5 95.1 17.9% 0.0% 0.0% 0.0% 3.12sec 883728 300.10sec
visions visions solar_empowerment 279729 527068 1756 15.50 6800 0 77.5 77.5 0.0% 0.0% 0.0% 0.0% 3.79sec 527068 300.10sec
visions visions starsurge 78674 3817715 12721 12.78 50706 101352 64.2 63.9 17.8% 0.0% 0.0% 0.0% 4.73sec 3817715 300.10sec
visions visions stellar_flare 202347 37347 124 2.56 2474 4946 12.8 12.8 18.0% 0.0% 0.0% 0.0% 23.57sec 499111 300.10sec
visions visions stellar_flare ticks -202347 461764 1539 44.68 1753 3503 12.8 223.4 17.9% 0.0% 0.0% 0.0% 23.57sec 499111 300.10sec
visions visions streaking_stars 272873 2551329 8502 26.19 16515 33031 131.0 131.0 17.9% 0.0% 0.0% 0.0% 2.20sec 2551329 300.10sec
visions visions sunfire 93402 85288 284 3.60 4019 8038 18.0 18.0 17.9% 0.0% 0.0% 0.0% 16.69sec 856079 300.10sec
visions visions sunfire ticks -93402 770791 2569 44.98 2905 5807 18.0 224.9 18.0% 0.0% 0.0% 0.0% 16.69sec 856079 300.10sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.42sec 0 300.10sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.04sec 0 300.10sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
worldvein worldvein heed_my_call 271685 87352 291 1.63 9106 18211 8.1 8.1 17.9% 0.0% 0.0% 0.0% 33.53sec 87352 300.10sec
worldvein worldvein heed_my_call_aoe 271686 37340 124 1.63 3902 7807 8.1 8.1 17.6% 0.0% 0.0% 0.0% 33.53sec 37340 300.10sec
worldvein worldvein lunar_strike 194153 1596831 5321 15.21 17795 35571 76.1 76.1 18.0% 0.0% 0.0% 0.0% 3.85sec 1596831 300.10sec
worldvein worldvein moonfire 8921 50832 169 2.82 3059 6113 14.1 14.1 18.0% 0.0% 0.0% 0.0% 21.32sec 784590 300.10sec
worldvein worldvein moonfire ticks -8921 733758 2446 44.17 2818 5631 14.1 220.8 17.9% 0.0% 0.0% 0.0% 21.32sec 784590 300.10sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.10sec
worldvein worldvein shooting_stars 202497 253987 846 8.80 4891 9770 44.0 44.0 18.0% 0.0% 0.0% 0.0% 6.62sec 253987 300.10sec
worldvein worldvein solar_wrath 190984 888543 2961 18.39 8188 16370 91.5 92.0 18.0% 0.0% 0.0% 0.0% 3.21sec 888543 300.10sec
worldvein worldvein solar_empowerment 279729 519087 1730 14.65 7082 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 519087 300.10sec
worldvein worldvein starsurge 78674 3729090 12426 12.05 52481 104859 60.5 60.3 17.9% 0.0% 0.0% 0.0% 4.99sec 3729090 300.10sec
worldvein worldvein stellar_flare 202347 38515 128 2.55 2567 5132 12.7 12.7 17.7% 0.0% 0.0% 0.0% 23.57sec 509098 300.10sec
worldvein worldvein stellar_flare ticks -202347 470584 1569 43.70 1826 3650 12.7 218.5 18.0% 0.0% 0.0% 0.0% 23.57sec 509098 300.10sec
worldvein worldvein streaking_stars 272873 1710248 5699 17.73 16350 32700 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.13sec 1710248 300.10sec
worldvein worldvein sunfire 93402 88811 296 3.59 4194 8395 18.0 18.0 17.9% 0.0% 0.0% 0.0% 16.61sec 874006 300.10sec
worldvein worldvein sunfire ticks -93402 785195 2617 44.00 3026 6048 18.0 220.0 18.0% 0.0% 0.0% 0.0% 16.61sec 874006 300.10sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 300.10sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
416577.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 13.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.73% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.30% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.04% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.99% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.76% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.75% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.05% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.9sec 182.9sec 6.76% 9.11% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.8 64.3 28.5sec 3.8sec 43.88% 0.00% 64.3(64.3) 10.6

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:43.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 416576.96
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7806
Mean 300.10
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7806
Mean 445716.81
Minimum 423241.08
Maximum 471604.32
Spread ( max - min ) 48363.24
Range [ ( max - min ) / 2 * 100% ] 5.43%
Standard Deviation 8979.8041
5th Percentile 431957.06
95th Percentile 460159.09
( 95th Percentile - 5th Percentile ) 28202.03
Mean Distribution
Standard Deviation 101.6372
95.00% Confidence Intervall ( 445517.61 - 445916.02 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1560
0.1 Scale Factor Error with Delta=300 688363
0.05 Scale Factor Error with Delta=300 2753452
0.01 Scale Factor Error with Delta=300 68836280
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7806
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1664
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 138156778 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n